Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3761
Gene name	Potassium inwardly rectifying channel subfamily J member 4
Gene symbol	KCNJ4
Synonyms (NCBI Gene)	HIRHIRK2HRK1IRK-3IRK3Kir2.3
Chromosome	22
Chromosome location	22q13.1
Summary	Several different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT504603	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT504599	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT504603	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT504599	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT504603	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	22012620
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT504603	hsa-miR-493-3p	PAR-CLIP	22012620
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT504599	hsa-miR-510-3p	PAR-CLIP	22012620
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT504603	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT504599	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT504603	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT504599	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT504603	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT504599	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT504603	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT504599	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT504603	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	22012620
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT504603	hsa-miR-493-3p	PAR-CLIP	22012620
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT504599	hsa-miR-510-3p	PAR-CLIP	22012620
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT504603	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT504599	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT504606	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT504605	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT504604	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT504603	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT504602	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT504601	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT504600	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT504599	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT1081538	hsa-miR-1293	CLIP-seq
MIRT1081539	hsa-miR-3144-5p	CLIP-seq
MIRT1081540	hsa-miR-3145-3p	CLIP-seq
MIRT1081541	hsa-miR-3165	CLIP-seq
MIRT1081542	hsa-miR-3649	CLIP-seq
MIRT1081543	hsa-miR-4483	CLIP-seq
MIRT1081544	hsa-miR-4699-3p	CLIP-seq
MIRT1081545	hsa-miR-520d-5p	CLIP-seq
MIRT1081546	hsa-miR-524-5p	CLIP-seq
MIRT2465512	hsa-miR-4274	CLIP-seq
MIRT2465513	hsa-miR-4530	CLIP-seq
MIRT2465514	hsa-miR-455-3p	CLIP-seq
MIRT2465515	hsa-miR-4691-3p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005242	Function	Inward rectifier potassium channel activity	IBA
GO:0005242	Function	Inward rectifier potassium channel activity	IDA	8016146, 8034048, 8051145
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	IMP	7576658
GO:0005242	Function	Inward rectifier potassium channel activity	TAS	8016146
GO:0005515	Function	Protein binding	IPI	16855024, 24550280, 30126976
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	8051145
GO:0008076	Component	Voltage-gated potassium channel complex	TAS	8051145
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	16855024
GO:0030165	Function	PDZ domain binding	IPI	16855024
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:1990573	Process	Potassium ion import across plasma membrane	IBA

MIM	HGNC	e!Ensembl
600504	6265	ENSG00000168135

P48050

Protein name

Inward rectifier potassium channel 4 (HIRK2) (HRK1) (Hippocampal inward rectifier) (HIR) (Inward rectifier K(+) channel Kir2.3) (IRK-3) (Potassium channel, inwardly rectifying subfamily J member 4)

Protein function

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potass

PDB

3GJ9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	22 → 178	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	185 → 358	Inward rectifier potassium channel C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, skeletal muscle, and several different brain regions including the hippocampus.

Sequence

MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG
FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
SHLDLERMQASLPLDNISYRRESAI

Sequence length

445

Interactions

View interactions

	KEGG		Reactome
	Cholinergic synapse Oxytocin signaling pathway		Activation of G protein gated Potassium channels Classical Kir channels Phase 4 - resting membrane potential Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30512237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	30512237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia totalis	Alopecia	BEFREE	11886538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	20657029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	24800985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conotruncal defect	Conotruncal defect	GWASDB_DG	24800985		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONOTRUNCAL HEART MALFORMATIONS (disorder)	Conotruncal heart defect	GWASCAT_DG	24800985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	1711209, 1764093, 7681983, 7821730, 8359580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	24427266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	10819237, 17563366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28495528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30512237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	18619942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	3039503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	15920292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KCNJ4 (potassium inwardly rectifying channel subfamily J member 4)