KCNJ3 (potassium inwardly rectifying channel subfamily J member 3)

Gene

• Entrez ID: 3760
• Gene name: Potassium inwardly rectifying channel subfamily J member 3
• Gene symbol: KCNJ3
• Synonyms (NCBI Gene): GIRK1, KGA, KIR3.1
• Chromosome: 2
• Chromosome location: 2q24.1
• Summary: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT506909	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506908	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT506907	hsa-miR-567	HITS-CLIP	21572407
MIRT506906	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506904	hsa-miR-3924	HITS-CLIP	21572407
MIRT506903	hsa-miR-297	HITS-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT506908	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT506906	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT506904	hsa-miR-3924	PAR-CLIP	20371350
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT522899	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT556831	hsa-miR-8485	PAR-CLIP	21572407
MIRT556830	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT556829	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT556828	hsa-miR-603	PAR-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT506908	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT506907	hsa-miR-567	PAR-CLIP	21572407
MIRT506906	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT556827	hsa-miR-3941	PAR-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506904	hsa-miR-3924	PAR-CLIP	21572407
MIRT506903	hsa-miR-297	PAR-CLIP	21572407
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT522899	hsa-miR-361-5p	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506908	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT506907	hsa-miR-567	HITS-CLIP	21572407
MIRT506906	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506904	hsa-miR-3924	HITS-CLIP	21572407
MIRT506903	hsa-miR-297	HITS-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT506908	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT506906	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT506904	hsa-miR-3924	PAR-CLIP	20371350
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT522899	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT556831	hsa-miR-8485	PAR-CLIP	21572407
MIRT556830	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT556829	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT556828	hsa-miR-603	PAR-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT506908	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT506907	hsa-miR-567	PAR-CLIP	21572407
MIRT506906	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT556827	hsa-miR-3941	PAR-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506904	hsa-miR-3924	PAR-CLIP	21572407
MIRT506903	hsa-miR-297	PAR-CLIP	21572407
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT522899	hsa-miR-361-5p	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1081535	hsa-miR-410	CLIP-seq
MIRT1081536	hsa-miR-4270	CLIP-seq
MIRT1081537	hsa-miR-4441	CLIP-seq
MIRT2020200	hsa-miR-300	CLIP-seq
MIRT2020201	hsa-miR-3180-5p	CLIP-seq
MIRT2020202	hsa-miR-381	CLIP-seq
MIRT2020203	hsa-miR-4328	CLIP-seq
MIRT2020204	hsa-miR-4666-3p	CLIP-seq
MIRT2020205	hsa-miR-510	CLIP-seq
MIRT2020206	hsa-miR-512-5p	CLIP-seq
MIRT2020207	hsa-miR-520a-5p	CLIP-seq
MIRT2020208	hsa-miR-525-5p	CLIP-seq
MIRT2452210	hsa-miR-142-5p	CLIP-seq
MIRT2452211	hsa-miR-30a	CLIP-seq
MIRT2452212	hsa-miR-30b	CLIP-seq
MIRT2452213	hsa-miR-30c	CLIP-seq
MIRT2452214	hsa-miR-30d	CLIP-seq
MIRT2452215	hsa-miR-30e	CLIP-seq
MIRT2452216	hsa-miR-548a-5p	CLIP-seq
MIRT2452217	hsa-miR-548ab	CLIP-seq
MIRT2452218	hsa-miR-548ak	CLIP-seq
MIRT2452219	hsa-miR-548b-5p	CLIP-seq
MIRT2452220	hsa-miR-548c-5p	CLIP-seq
MIRT2452221	hsa-miR-548d-5p	CLIP-seq
MIRT2452222	hsa-miR-548h	CLIP-seq
MIRT2452223	hsa-miR-548i	CLIP-seq
MIRT2452224	hsa-miR-548j	CLIP-seq
MIRT2452225	hsa-miR-548k	CLIP-seq
MIRT2452226	hsa-miR-548l	CLIP-seq
MIRT2452227	hsa-miR-548w	CLIP-seq
MIRT2452228	hsa-miR-548y	CLIP-seq
MIRT2452229	hsa-miR-559	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005242	Function	Inward rectifier potassium channel activity	IDA	12297500, 20560207
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	12297500
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	8804710
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	20560207
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	TAS	8804710
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0015467	Function	G-protein activated inward rectifier potassium channel activity	IDA	8804710, 8868049
GO:0015467	Function	G-protein activated inward rectifier potassium channel activity	IEA
GO:0015467	Function	G-protein activated inward rectifier potassium channel activity	IEA
GO:0015467	Function	G-protein activated inward rectifier potassium channel activity	TAS	8804710
GO:0016020	Component	Membrane	IEA
GO:0030315	Component	T-tubule	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0071805	Process	Potassium ion transmembrane transport	NAS	19703462
GO:0086089	Function	Voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization	IC	20560207
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IC	20560207
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098914	Process	Membrane repolarization during atrial cardiac muscle cell action potential	IC	20560207
GO:0098915	Process	Membrane repolarization during ventricular cardiac muscle cell action potential	IEA
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IEA
GO:0099625	Process	Ventricular cardiac muscle cell membrane repolarization	IC	20560207
GO:1902282	Function	Voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	IC	20560207
GO:1902937	Component	Inward rectifier potassium channel complex	IEA
GO:1990566	Component	I(KACh) inward rectifier potassium channel complex	ISO
GO:1990573	Process	Potassium ion import across plasma membrane	IBA
GO:1990573	Process	Potassium ion import across plasma membrane	IDA	20560207

Other IDs

• MIM: 601534
• HGNC: 6264
• e!Ensembl: ENSG00000162989

Protein

• UniProt ID: P48549
• Protein name: G protein-activated inward rectifier potassium channel 1 (GIRK-1) (Inward rectifier K(+) channel Kir3.1) (Potassium channel, inwardly rectifying subfamily J member 3)
• Protein function: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potass
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01007	IRK	47 → 187	Inward rectifier potassium channel transmembrane domain	Domain
  PF17655	IRK_C	194 → 365	Inward rectifier potassium channel C-terminal domain	Domain

• Sequence:

  MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
  GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
  TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
  FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
  GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
  GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
  QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
  STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
  AARMEGNLPAKLRKMNSDRFT

• Sequence length: 501

Pathways

KEGG:

Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Oxytocin signaling pathway
GnRH secretion
Morphine addiction

Reactome:

Activation of G protein gated Potassium channels
Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY ATRIAL FIBRILLATION	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALUNION FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEAL MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	19465885		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30764634		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36068227	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	21927946	Inhibit	★☆☆☆☆ Found in Text Mining only
Bradyarrhythmia (disorder)	Bradyarrhythmia	BEFREE	30764634		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11212253, 20512921, 27519272, 27698251, 31848385		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15603589, 27519272, 27698251, 27835900, 28252570, 31848385	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28804970		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28804970		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28804970	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30978208		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	8621016		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24096582		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24096582		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	27957763		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen Storage Disease	LHGDN	12034888		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	12034888	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34588502	Associate	★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	34957562	Associate	★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	BEFREE	30978208		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	12458027		★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	10686544		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30555042		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16109170		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15541182, 31848385	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27519272, 27698251	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	28252570	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17940881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20512921, 27519272, 27698251, 31848385		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15541182, 17940881		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20512921, 31848385		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11212253, 15541182, 17940881, 22892846, 27519272, 31848385		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8643076		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15541182		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21927946		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21927946		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21927946	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21927946	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sinus Node Dysfunction (disorder)	Sinus Node Dysfunction	BEFREE	20110696, 30645171		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28951616		★☆☆☆☆ Found in Text Mining only