Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	375056
Gene name	MIA SH3 domain ER export factor 3
Gene symbol	MIA3
Synonyms (NCBI Gene)	ARNTD320ODCD2TANGOTANGO1UNQ6077
Chromosome	1
Chromosome location	1q41

324

Show/Hide all (324)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029370	hsa-miR-26b-5p	Microarray	19088304
MIRT717961	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT717960	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT717959	hsa-miR-3928-5p	HITS-CLIP	19536157
MIRT717958	hsa-miR-6806-3p	HITS-CLIP	19536157
MIRT717957	hsa-miR-4268	HITS-CLIP	19536157
MIRT717956	hsa-miR-4448	HITS-CLIP	19536157
MIRT717955	hsa-miR-3140-3p	HITS-CLIP	19536157
MIRT717954	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT717953	hsa-miR-127-5p	HITS-CLIP	19536157
MIRT717952	hsa-miR-6772-3p	HITS-CLIP	19536157
MIRT717951	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT717950	hsa-miR-2681-5p	HITS-CLIP	19536157
MIRT623248	hsa-miR-4528	HITS-CLIP	23824327
MIRT623247	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT623246	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT623248	hsa-miR-4528	HITS-CLIP	23824327
MIRT623247	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT623246	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT623248	hsa-miR-4528	HITS-CLIP	23824327
MIRT623247	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT623246	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT535955	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT535954	hsa-miR-3124-3p	PAR-CLIP	22012620
MIRT535953	hsa-miR-4724-3p	PAR-CLIP	22012620
MIRT535952	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT535951	hsa-miR-5571-3p	PAR-CLIP	22012620
MIRT535950	hsa-miR-7975	PAR-CLIP	22012620
MIRT535949	hsa-miR-3685	PAR-CLIP	22012620
MIRT535948	hsa-miR-384	PAR-CLIP	22012620
MIRT727205	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727206	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727204	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727203	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727202	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT727201	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT727199	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT727200	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT717961	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT717960	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT717959	hsa-miR-3928-5p	HITS-CLIP	19536157
MIRT717958	hsa-miR-6806-3p	HITS-CLIP	19536157
MIRT717957	hsa-miR-4268	HITS-CLIP	19536157
MIRT717956	hsa-miR-4448	HITS-CLIP	19536157
MIRT717955	hsa-miR-3140-3p	HITS-CLIP	19536157
MIRT717954	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT717953	hsa-miR-127-5p	HITS-CLIP	19536157
MIRT717952	hsa-miR-6772-3p	HITS-CLIP	19536157
MIRT717951	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT717950	hsa-miR-2681-5p	HITS-CLIP	19536157
MIRT623248	hsa-miR-4528	HITS-CLIP	23824327
MIRT623247	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT623246	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT623248	hsa-miR-4528	HITS-CLIP	23824327
MIRT623247	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT623246	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT623248	hsa-miR-4528	HITS-CLIP	23824327
MIRT623247	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT623246	hsa-miR-4795-3p	HITS-CLIP	23824327
MIRT535955	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT535954	hsa-miR-3124-3p	PAR-CLIP	22012620
MIRT535953	hsa-miR-4724-3p	PAR-CLIP	22012620
MIRT535952	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT535951	hsa-miR-5571-3p	PAR-CLIP	22012620
MIRT535950	hsa-miR-7975	PAR-CLIP	22012620
MIRT535949	hsa-miR-3685	PAR-CLIP	22012620
MIRT535948	hsa-miR-384	PAR-CLIP	22012620
MIRT1147721	hsa-miR-1236	CLIP-seq
MIRT1147722	hsa-miR-1245b-3p	CLIP-seq
MIRT1147723	hsa-miR-1256	CLIP-seq
MIRT1147724	hsa-miR-1294	CLIP-seq
MIRT1147725	hsa-miR-137	CLIP-seq
MIRT1147726	hsa-miR-219-2-3p	CLIP-seq
MIRT1147727	hsa-miR-221	CLIP-seq
MIRT1147728	hsa-miR-222	CLIP-seq
MIRT1147729	hsa-miR-24	CLIP-seq
MIRT1147730	hsa-miR-25	CLIP-seq
MIRT1147731	hsa-miR-2964a-3p	CLIP-seq
MIRT1147732	hsa-miR-3134	CLIP-seq
MIRT1147733	hsa-miR-3146	CLIP-seq
MIRT1147734	hsa-miR-32	CLIP-seq
MIRT1147735	hsa-miR-323-3p	CLIP-seq
MIRT1147736	hsa-miR-340	CLIP-seq
MIRT1147737	hsa-miR-3591-3p	CLIP-seq
MIRT1147738	hsa-miR-3613-3p	CLIP-seq
MIRT1147739	hsa-miR-363	CLIP-seq
MIRT1147740	hsa-miR-367	CLIP-seq
MIRT1147741	hsa-miR-371b-5p	CLIP-seq
MIRT1147742	hsa-miR-382	CLIP-seq
MIRT1147743	hsa-miR-3915	CLIP-seq
MIRT1147744	hsa-miR-3928	CLIP-seq
MIRT1147745	hsa-miR-3973	CLIP-seq
MIRT1147746	hsa-miR-4275	CLIP-seq
MIRT1147747	hsa-miR-4284	CLIP-seq
MIRT1147748	hsa-miR-4316	CLIP-seq
MIRT1147749	hsa-miR-4452	CLIP-seq
MIRT1147750	hsa-miR-4678	CLIP-seq
MIRT1147751	hsa-miR-4764-5p	CLIP-seq
MIRT1147752	hsa-miR-520g	CLIP-seq
MIRT1147753	hsa-miR-520h	CLIP-seq
MIRT1147754	hsa-miR-548v	CLIP-seq
MIRT1147755	hsa-miR-607	CLIP-seq
MIRT1147756	hsa-miR-630	CLIP-seq
MIRT1147757	hsa-miR-92a	CLIP-seq
MIRT1147758	hsa-miR-92b	CLIP-seq
MIRT2042054	hsa-miR-1279	CLIP-seq
MIRT2042055	hsa-miR-1283	CLIP-seq
MIRT2042056	hsa-miR-132	CLIP-seq
MIRT2042057	hsa-miR-212	CLIP-seq
MIRT1147727	hsa-miR-221	CLIP-seq
MIRT1147728	hsa-miR-222	CLIP-seq
MIRT2042058	hsa-miR-3133	CLIP-seq
MIRT2042059	hsa-miR-3175	CLIP-seq
MIRT1147735	hsa-miR-323-3p	CLIP-seq
MIRT2042060	hsa-miR-3591-5p	CLIP-seq
MIRT2042061	hsa-miR-3688-3p	CLIP-seq
MIRT2042062	hsa-miR-3692	CLIP-seq
MIRT1147746	hsa-miR-4275	CLIP-seq
MIRT2042063	hsa-miR-4291	CLIP-seq
MIRT2042064	hsa-miR-4480	CLIP-seq
MIRT2042065	hsa-miR-4511	CLIP-seq
MIRT2042066	hsa-miR-451b	CLIP-seq
MIRT2042067	hsa-miR-4704-5p	CLIP-seq
MIRT2042068	hsa-miR-4799-5p	CLIP-seq
MIRT2042069	hsa-miR-520d-5p	CLIP-seq
MIRT2042070	hsa-miR-524-5p	CLIP-seq
MIRT2042071	hsa-miR-545	CLIP-seq
MIRT2042072	hsa-miR-548c-3p	CLIP-seq
MIRT2271767	hsa-miR-1245	CLIP-seq
MIRT2271768	hsa-miR-1251	CLIP-seq
MIRT2271769	hsa-miR-125a-3p	CLIP-seq
MIRT2042055	hsa-miR-1283	CLIP-seq
MIRT2271770	hsa-miR-1284	CLIP-seq
MIRT1147725	hsa-miR-137	CLIP-seq
MIRT2271771	hsa-miR-21	CLIP-seq
MIRT1147729	hsa-miR-24	CLIP-seq
MIRT1147730	hsa-miR-25	CLIP-seq
MIRT2271772	hsa-miR-27a	CLIP-seq
MIRT2271773	hsa-miR-27b	CLIP-seq
MIRT2042058	hsa-miR-3133	CLIP-seq
MIRT2042059	hsa-miR-3175	CLIP-seq
MIRT2271774	hsa-miR-3187-3p	CLIP-seq
MIRT1147734	hsa-miR-32	CLIP-seq
MIRT2042060	hsa-miR-3591-5p	CLIP-seq
MIRT2271775	hsa-miR-3606	CLIP-seq
MIRT2271776	hsa-miR-3614-5p	CLIP-seq
MIRT1147739	hsa-miR-363	CLIP-seq
MIRT1147740	hsa-miR-367	CLIP-seq
MIRT2271777	hsa-miR-3674	CLIP-seq
MIRT2042061	hsa-miR-3688-3p	CLIP-seq
MIRT2042062	hsa-miR-3692	CLIP-seq
MIRT1147742	hsa-miR-382	CLIP-seq
MIRT1147745	hsa-miR-3973	CLIP-seq
MIRT2271778	hsa-miR-421	CLIP-seq
MIRT2271779	hsa-miR-425	CLIP-seq
MIRT2271780	hsa-miR-4257	CLIP-seq
MIRT1147747	hsa-miR-4284	CLIP-seq
MIRT2042063	hsa-miR-4291	CLIP-seq
MIRT2271781	hsa-miR-4422	CLIP-seq
MIRT2042065	hsa-miR-4511	CLIP-seq
MIRT2042066	hsa-miR-451b	CLIP-seq
MIRT2271782	hsa-miR-4529-5p	CLIP-seq
MIRT1147750	hsa-miR-4678	CLIP-seq
MIRT2042067	hsa-miR-4704-5p	CLIP-seq
MIRT2271783	hsa-miR-4709-5p	CLIP-seq
MIRT2271784	hsa-miR-4732-5p	CLIP-seq
MIRT2271785	hsa-miR-505	CLIP-seq
MIRT2271786	hsa-miR-513a-5p	CLIP-seq
MIRT2042069	hsa-miR-520d-5p	CLIP-seq
MIRT1147752	hsa-miR-520g	CLIP-seq
MIRT1147753	hsa-miR-520h	CLIP-seq
MIRT2042070	hsa-miR-524-5p	CLIP-seq
MIRT2042071	hsa-miR-545	CLIP-seq
MIRT2042072	hsa-miR-548c-3p	CLIP-seq
MIRT2271787	hsa-miR-552	CLIP-seq
MIRT2271788	hsa-miR-590-5p	CLIP-seq
MIRT1147755	hsa-miR-607	CLIP-seq
MIRT1147756	hsa-miR-630	CLIP-seq
MIRT2271789	hsa-miR-642b	CLIP-seq
MIRT2271790	hsa-miR-921	CLIP-seq
MIRT1147757	hsa-miR-92a	CLIP-seq
MIRT1147758	hsa-miR-92b	CLIP-seq
MIRT2042071	hsa-miR-545	CLIP-seq
MIRT2438586	hsa-miR-1200	CLIP-seq
MIRT2438587	hsa-miR-3074-5p	CLIP-seq
MIRT2438588	hsa-miR-3140-5p	CLIP-seq
MIRT2438589	hsa-miR-3185	CLIP-seq
MIRT2438590	hsa-miR-4753-3p	CLIP-seq
MIRT2454072	hsa-miR-1267	CLIP-seq
MIRT2454073	hsa-miR-139-5p	CLIP-seq
MIRT2454074	hsa-miR-15a	CLIP-seq
MIRT2454075	hsa-miR-15b	CLIP-seq
MIRT2454076	hsa-miR-16	CLIP-seq
MIRT2454077	hsa-miR-186	CLIP-seq
MIRT2454078	hsa-miR-195	CLIP-seq
MIRT1147729	hsa-miR-24	CLIP-seq
MIRT2454079	hsa-miR-3117-3p	CLIP-seq
MIRT2454080	hsa-miR-3121-3p	CLIP-seq
MIRT2454081	hsa-miR-3153	CLIP-seq
MIRT2454082	hsa-miR-3169	CLIP-seq
MIRT1147738	hsa-miR-3613-3p	CLIP-seq
MIRT2271776	hsa-miR-3614-5p	CLIP-seq
MIRT2454083	hsa-miR-3651	CLIP-seq
MIRT2454084	hsa-miR-3671	CLIP-seq
MIRT2454085	hsa-miR-371-5p	CLIP-seq
MIRT1147741	hsa-miR-371b-5p	CLIP-seq
MIRT2454086	hsa-miR-3919	CLIP-seq
MIRT2454087	hsa-miR-424	CLIP-seq
MIRT1147746	hsa-miR-4275	CLIP-seq
MIRT1147747	hsa-miR-4284	CLIP-seq
MIRT2454088	hsa-miR-4330	CLIP-seq
MIRT2454089	hsa-miR-4464	CLIP-seq
MIRT2454090	hsa-miR-4524	CLIP-seq
MIRT2454091	hsa-miR-4639-3p	CLIP-seq
MIRT2454092	hsa-miR-4652-3p	CLIP-seq
MIRT2454093	hsa-miR-4668-5p	CLIP-seq
MIRT2454094	hsa-miR-4700-3p	CLIP-seq
MIRT2042067	hsa-miR-4704-5p	CLIP-seq
MIRT2454095	hsa-miR-4748	CLIP-seq
MIRT2454096	hsa-miR-4756-3p	CLIP-seq
MIRT2454097	hsa-miR-4759	CLIP-seq
MIRT2454098	hsa-miR-4790-3p	CLIP-seq
MIRT2454099	hsa-miR-497	CLIP-seq
MIRT2454100	hsa-miR-499-3p	CLIP-seq
MIRT2454101	hsa-miR-499a-3p	CLIP-seq
MIRT2454102	hsa-miR-503	CLIP-seq
MIRT2454103	hsa-miR-513c	CLIP-seq
MIRT2454104	hsa-miR-514b-5p	CLIP-seq
MIRT2454105	hsa-miR-548aa	CLIP-seq
MIRT2454106	hsa-miR-548ac	CLIP-seq
MIRT2454107	hsa-miR-548ae	CLIP-seq
MIRT2454108	hsa-miR-548aj	CLIP-seq
MIRT2454109	hsa-miR-548am	CLIP-seq
MIRT2454110	hsa-miR-548d-3p	CLIP-seq
MIRT2454111	hsa-miR-548x	CLIP-seq
MIRT2454112	hsa-miR-548z	CLIP-seq
MIRT2454113	hsa-miR-556-5p	CLIP-seq
MIRT2454114	hsa-miR-579	CLIP-seq
MIRT1147755	hsa-miR-607	CLIP-seq
MIRT2454115	hsa-miR-610	CLIP-seq
MIRT2271789	hsa-miR-642b	CLIP-seq
MIRT2454116	hsa-miR-646	CLIP-seq
MIRT2454117	hsa-miR-7	CLIP-seq
MIRT2454077	hsa-miR-186	CLIP-seq
MIRT2454079	hsa-miR-3117-3p	CLIP-seq
MIRT2454082	hsa-miR-3169	CLIP-seq
MIRT2454097	hsa-miR-4759	CLIP-seq
MIRT2454117	hsa-miR-7	CLIP-seq
MIRT2570704	hsa-miR-1185	CLIP-seq
MIRT2570705	hsa-miR-1257	CLIP-seq
MIRT2271770	hsa-miR-1284	CLIP-seq
MIRT2570706	hsa-miR-140-3p	CLIP-seq
MIRT2570707	hsa-miR-183	CLIP-seq
MIRT2454077	hsa-miR-186	CLIP-seq
MIRT1147727	hsa-miR-221	CLIP-seq
MIRT1147728	hsa-miR-222	CLIP-seq
MIRT1147729	hsa-miR-24	CLIP-seq
MIRT2570708	hsa-miR-300	CLIP-seq
MIRT2570709	hsa-miR-3065-5p	CLIP-seq
MIRT2454080	hsa-miR-3121-3p	CLIP-seq
MIRT2042058	hsa-miR-3133	CLIP-seq
MIRT1147733	hsa-miR-3146	CLIP-seq
MIRT2454081	hsa-miR-3153	CLIP-seq
MIRT2570710	hsa-miR-3157-5p	CLIP-seq
MIRT2570711	hsa-miR-3168	CLIP-seq
MIRT1147735	hsa-miR-323-3p	CLIP-seq
MIRT2570712	hsa-miR-3605-5p	CLIP-seq
MIRT2570713	hsa-miR-3607-5p	CLIP-seq
MIRT2271776	hsa-miR-3614-5p	CLIP-seq
MIRT2454084	hsa-miR-3671	CLIP-seq
MIRT2570714	hsa-miR-3679-5p	CLIP-seq
MIRT2570715	hsa-miR-3714	CLIP-seq
MIRT2454085	hsa-miR-371-5p	CLIP-seq
MIRT1147741	hsa-miR-371b-5p	CLIP-seq
MIRT2570716	hsa-miR-381	CLIP-seq
MIRT2454086	hsa-miR-3919	CLIP-seq
MIRT2570717	hsa-miR-410	CLIP-seq
MIRT1147746	hsa-miR-4275	CLIP-seq
MIRT1147747	hsa-miR-4284	CLIP-seq
MIRT2454088	hsa-miR-4330	CLIP-seq
MIRT2271781	hsa-miR-4422	CLIP-seq
MIRT2042064	hsa-miR-4480	CLIP-seq
MIRT2570718	hsa-miR-450b-5p	CLIP-seq
MIRT2454091	hsa-miR-4639-3p	CLIP-seq
MIRT2570719	hsa-miR-4666-3p	CLIP-seq
MIRT2454093	hsa-miR-4668-5p	CLIP-seq
MIRT2570720	hsa-miR-4691-3p	CLIP-seq
MIRT2570721	hsa-miR-4699-3p	CLIP-seq
MIRT2454096	hsa-miR-4756-3p	CLIP-seq
MIRT2042068	hsa-miR-4799-5p	CLIP-seq
MIRT2570722	hsa-miR-495	CLIP-seq
MIRT2570723	hsa-miR-507	CLIP-seq
MIRT2570724	hsa-miR-513a-3p	CLIP-seq
MIRT2454103	hsa-miR-513c	CLIP-seq
MIRT2454104	hsa-miR-514b-5p	CLIP-seq
MIRT2454105	hsa-miR-548aa	CLIP-seq
MIRT2042072	hsa-miR-548c-3p	CLIP-seq
MIRT1147754	hsa-miR-548v	CLIP-seq
MIRT2570725	hsa-miR-557	CLIP-seq
MIRT2570726	hsa-miR-606	CLIP-seq
MIRT2271789	hsa-miR-642b	CLIP-seq
MIRT2570727	hsa-miR-662	CLIP-seq
MIRT1147729	hsa-miR-24	CLIP-seq
MIRT2570709	hsa-miR-3065-5p	CLIP-seq
MIRT2454080	hsa-miR-3121-3p	CLIP-seq
MIRT2042058	hsa-miR-3133	CLIP-seq
MIRT2454081	hsa-miR-3153	CLIP-seq
MIRT2570711	hsa-miR-3168	CLIP-seq
MIRT2271776	hsa-miR-3614-5p	CLIP-seq
MIRT2454084	hsa-miR-3671	CLIP-seq
MIRT2570715	hsa-miR-3714	CLIP-seq
MIRT2454085	hsa-miR-371-5p	CLIP-seq
MIRT1147741	hsa-miR-371b-5p	CLIP-seq
MIRT2454086	hsa-miR-3919	CLIP-seq
MIRT1147747	hsa-miR-4284	CLIP-seq
MIRT2454088	hsa-miR-4330	CLIP-seq
MIRT2042064	hsa-miR-4480	CLIP-seq
MIRT2454091	hsa-miR-4639-3p	CLIP-seq
MIRT2454093	hsa-miR-4668-5p	CLIP-seq
MIRT2454096	hsa-miR-4756-3p	CLIP-seq
MIRT2570722	hsa-miR-495	CLIP-seq
MIRT2454103	hsa-miR-513c	CLIP-seq
MIRT2454104	hsa-miR-514b-5p	CLIP-seq
MIRT2454105	hsa-miR-548aa	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	28341552
GO:0002687	Process	Positive regulation of leukocyte migration	IDA	17726152
GO:0005515	Function	Protein binding	IPI	17726152, 19269366, 21525241, 25202031, 25416956, 27138255, 27170179, 27551091, 28442536, 32296183, 33961781
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	19269366
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006887	Process	Exocytosis	IEA
GO:0006887	Process	Exocytosis	IMP	19269366
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	27138255
GO:0007029	Process	Endoplasmic reticulum organization	IMP	28442536
GO:0007162	Process	Negative regulation of cell adhesion	IDA	17726152
GO:0009306	Process	Protein secretion	IBA
GO:0015031	Process	Protein transport	IEA
GO:0015031	Process	Protein transport	IMP	19269366
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	19269366
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030336	Process	Negative regulation of cell migration	IDA	17044017
GO:0035459	Process	Vesicle cargo loading	IBA
GO:0038024	Function	Cargo receptor activity	IMP	27138255
GO:0042060	Process	Wound healing	IDA	17044017
GO:0042953	Process	Lipoprotein transport	IMP	27138255
GO:0048731	Process	System development	IEA
GO:0070971	Component	Endoplasmic reticulum exit site	IBA
GO:0070971	Component	Endoplasmic reticulum exit site	IDA	21525241, 25202031, 28442536
GO:0070973	Process	Protein localization to endoplasmic reticulum exit site	IMP	28442536
GO:0090110	Process	COPII-coated vesicle cargo loading	IMP	27138255
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	28341552
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	28341552
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	28341552

MIM	HGNC	e!Ensembl
613455	24008	ENSG00000154305

Q5JRA6

Protein name

Transport and Golgi organization protein 1 homolog (TANGO1) (C219-reactive peptide) (D320) (Melanoma inhibitory activity protein 3)

Protein function

Plays a role in the transport of cargos that are too large to fit into COPII-coated vesicles and require specific mechanisms to be incorporated into membrane-bound carriers and exported from the endoplasmic reticulum. This protein is required fo

PDB

5KYN , 5KYU , 5KYW , 7R3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07653	SH3_2	49 → 105	Variant SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Broadly expressed, except in bone marrow and peripheral blood mononuclear cells. Down-regulated in melanoma tissue. {ECO:0000269|PubMed:15183315, ECO:0000269|PubMed:17044017}.

Sequence

MAAAPGLLVWLLVLRLPWRVPGQLDPSTGRRFSEHKLCADDECSMLMYRGEALEDFTGPD
CRFVNFKKGDPVYVYYKLARGWPEVWAGSVGRTFGYFPKDLIQVVHEYTKEELQVPTDET
DFVCFDGGRDDFHNYNVEELLGFLELYNSAATDSEKAVEKTLQDMEKNPELSKEREPEPE
PVEANSEESDSVFSENTEDLQEQFTTQKHHSHANSQANHAQGEQASFESFEEMLQDKLKV
PESENNKTSNSSQVSNEQDKIDAYKLLKKEMTLDLKTKFGSTADALVSDDETTRLVTSLE
DDFDEELDTEYYAVGKEDEENQEDFDELPLLTFTDGEDMKTPAKSGVEKYPTDKEQNSNE
EDKVQLTVPPGIKNDDKNILTTWGDTIFSIVTGGEETRDTMDLESSSSEEEKEDDDDALV
PDSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQ
DKTELEDENQEGMTVHSSVHSNNLNSMPAAEKGKDTLKSAYDDTENDLKGAAIHISKGML
HEEKPGEQILEGGSESESAQKAAGNQMNDRKIQQESLGSAPLMGDDHPNASRDSVEGDAL
VNGAKLHTLSVEHQREELKEELVLKTQNQPRFSSPDEIDLPRELEDEVPILGRNLPWQQE
RDVAATASKQMSEKIRLSEGEAKEDSLDEEFFHHKAMQGTEVGQTDQTDSTGGPAFLSKV
EEDDYPSEELLEDENAINAKRSKEKNPGNQGRQFDVNLQVPDRAVLGTIHPDPEIEESKQ
ETSMILDSEKTSETAAKGVNTGGREPNTMVEKERPLADKKAQRPFERSDFSDSIKIQTPE
LGEVFQNKDSDYLKNDNPEEHLKTSGLAGEPEGELSKEDHENTEKYMGTESQGSAAAEPE
DDSFHWTPHTSVEPGHSDKREDLLIISSFFKEQQSLQRFQKYFNVHELEALLQEMSSKLK
SAQQESLPYNMEKVLDKVFRASESQILSIAEKMLDTRVAENRDLGMNENNIFEEAAVLDD
IQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPE
EPTHLDQRVIGDTHASEVSQKPNTEKDLDPGPVTTEDTPMDAIDANKQPETAAEEPASVT
PLENAILLIYSFMFYLTKSLVATLPDDVQPGPDFYGLPWKPVFITAFLGIASFAIFLWRT
VLVVKDRVYQVTEQQISEKLKTIMKENTELVQKLSNYEQKIKESKKHVQETRKQNMILSD
EAIKYKDKIKTLEKNQEILDDTAKNLRVMLESEREQNVKNQDLISENKKSIEKLKDVISM
NASEFSEVQIALNEAKLSEEKVKSECHRVQEENARLKKKKEQLQQEIEDWSKLHAELSEQ
IKSFEKSQKDLEVALTHKDDNINALTNCITQLNLLECESESEGQNKGGNDSDELANGEVG
GDRNEKMKNQIKQMMDVSRTQTAISVVEEDLKLLQLKLRASVSTKCNLEDQVKKLEDDRN
SLQAAKAGLEDECKTLRQKVEILNELYQQKEMALQKKLSQEEYERQEREHRLSAADEKAV
SAAEEVKTYKRRIEEMEDELQKTERSFKNQIATHEKKAHENWLKARAAERAIAEEKREAA
NLRHKLLELTQKMAMLQEEPVIVKPMPGKPNTQNPPRRGPLSQNGSFGPSPVSGGECSPP
LTVEPPVRPLSATLNRRDMPRSEFGSVDGPLPHPRWSAEASGKPSPSDPGSGTATMMNSS
SRGSSPTRVLDEGKVNMAPKGPPPFPGVPLMSTPMGGPVPPPIRYGPPPQLCGPFGPRPL
PPPFGPGMRPPLGLREFAPGVPPGRRDLPLHPRGFLPGHAPFRPLGSLGPREYFIPGTRL
PPPTHGPQEYPPPPAVRDLLPSGSRDEPPPASQSTSQDCSQALKQSP

Sequence length

1907

Interactions

View interactions

	Reactome
			Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Cargo concentration in the ER Post-translational protein phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
ODONTOCHONDRODYSPLASIA WITH HEARING LOSS AND DIABETES	Pathogenic	rs771534699	RCV001374392	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BONE FRAGILITY WITH CONTRACTURES, ARTERIAL RUPTURE, AND DEAFNESS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary artery disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Odontochondrodysplasia 2 with hearing loss and diabetes	Uncertain significance	ClinVar ClinVar, Disgenet, HPO ClinVar, Disgenet, HPO ClinVar, Disgenet, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OSTEOPOROSIS-PSEUDOGLIOMA SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (134)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma of large intestine	Colorectal adenoma	BEFREE	21081473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25769544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	27374485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22577832, 28341552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26838552	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35309329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22577832, 28341552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28341552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	31759816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11309328, 26046764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16567799, 24081025, 26046764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19203995, 22306343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25068796, 34258170, 37211171, 37948019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24916699, 29022645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19203995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	25343232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22577832, 31804579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	32879494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24249660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	31262291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35954202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20308559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	BEFREE	29504908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21081473, 23970287, 25839165, 28855850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	21081473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	21081473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21081473, 28742792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30625281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	26388611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22577832, 24125424, 28341552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	17634449, 19164808, 21698238, 25528061, 28341552, 35768776, 37474895	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	22577832, 24125424, 28341552, 28705542		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975, 29212778, 30104761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	21804106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	17634449, 21347282, 21378990, 21966275, 22319020		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	17634449, 21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	21804106, 22577832, 24125424, 27189819, 28341552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	BEFREE	25407435, 31594284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35954202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dentinogenesis Imperfecta	Dentinogenesis imperfecta	Pubtator	32101163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24990649, 31580427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24990649, 31580427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32101163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18366646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16096055, 16098823, 18366646, 19416713, 20440072, 23567972, 31580427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25769544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31540138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	22577832, 29190746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	17044017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11756572, 16084889, 26101050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	27977510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	27977510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	11394885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31800592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	22271822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30060750, 30213277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	32101163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	39684472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	32101163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	36368943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22871890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	11803471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10926858, 12354771, 12387890, 14992692, 17140257, 19287200, 20228066, 22387692, 24081025, 24618291, 25405996, 26572229, 34665260, 36429023, 8816435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27362802, 27448695, 29926531	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35290121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18366646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	32101163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	19131627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	29664738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29022645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10829078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10829078, 26637877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10849651, 12514119, 17786351, 21544813, 25068796, 8917436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17786351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	22271822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10849651, 12514119, 25068796, 8917436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35404107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of lower limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of upper limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11309328, 26046764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19177204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11394885, 23831623, 27448695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15479785, 23707522, 25068796, 25839165, 27145272, 28742792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20308559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16567799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26882907		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17044017, 17786351, 21926416, 21983785, 22577832, 25407435, 29655307, 31594284, 31741768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21926416, 21983785, 31630191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	21983785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29302888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	16364012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25669983, 29926531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29926531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18654002, 21463265, 28400043	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	19198609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	19198609, 26343387		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	19198609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	21264445, 21463265, 22577832		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	11309328, 12514119, 15878106, 16880289, 17044017, 17786351, 18172554, 19850893, 20709796, 21081473, 21544813, 22577832, 25068796, 25839165, 29022645, 29075999, 29427302 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nocturia	Nocturia	BEFREE	28075514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31800592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31800592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32078194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33418078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36368943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16410262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11394885, 23831623, 27448695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18359762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23831623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27448695	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30625281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22577832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	30946009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18335162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	28737528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31800592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19287200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19203995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11756572		★★★★★ ★☆☆☆☆ Found in Text Mining only

MIA3 (MIA SH3 domain ER export factor 3)