SPMIP8 (sperm microtubule inner protein 8)

Gene

• Entrez ID: 374739
• Gene name: Sperm microtubule inner protein 8
• Gene symbol: SPMIP8
• Synonyms (NCBI Gene): TEPP
• Chromosome: 16
• Chromosome location: 16q21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1418206	hsa-miR-515-5p	CLIP-seq
MIRT1418207	hsa-miR-1226	CLIP-seq
MIRT1418208	hsa-miR-361-3p	CLIP-seq
MIRT1418209	hsa-miR-371-5p	CLIP-seq
MIRT1418210	hsa-miR-371b-5p	CLIP-seq
MIRT1418211	hsa-miR-3943	CLIP-seq
MIRT1418212	hsa-miR-425	CLIP-seq
MIRT1418213	hsa-miR-4733-3p	CLIP-seq
MIRT2125448	hsa-miR-1228	CLIP-seq
MIRT2125449	hsa-miR-188-3p	CLIP-seq
MIRT2125450	hsa-miR-3144-5p	CLIP-seq
MIRT2125451	hsa-miR-3652	CLIP-seq
MIRT2125452	hsa-miR-4430	CLIP-seq
MIRT2125453	hsa-miR-532-3p	CLIP-seq
MIRT2125454	hsa-miR-596	CLIP-seq
MIRT1418207	hsa-miR-1226	CLIP-seq
MIRT1418213	hsa-miR-4733-3p	CLIP-seq
MIRT2347805	hsa-miR-942	CLIP-seq
MIRT2692892	hsa-miR-1262	CLIP-seq
MIRT2692893	hsa-miR-203	CLIP-seq
MIRT2692894	hsa-miR-3151	CLIP-seq
MIRT2692895	hsa-miR-4447	CLIP-seq
MIRT2692896	hsa-miR-4455	CLIP-seq
MIRT2692897	hsa-miR-4472	CLIP-seq
MIRT2692898	hsa-miR-4694-3p	CLIP-seq
MIRT2692899	hsa-miR-4701-3p	CLIP-seq
MIRT2692900	hsa-miR-4802-5p	CLIP-seq
MIRT2692901	hsa-miR-491-5p	CLIP-seq
MIRT2692902	hsa-miR-609	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0042995	Component	Cell projection	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	IBA
GO:0160111	Component	Axonemal A tubule inner sheath	IEA

Other IDs

• MIM: 610264
• HGNC: 33745
• e!Ensembl: ENSG00000159648

Protein

• UniProt ID: Q6URK8
• Protein name: Sperm microtubule inner protein 8 (Testis, prostate and placenta-expressed protein)
• Protein function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in flagellum axoneme. May serve to reinforce and thus stabilize the microtubule structure in the sperm flagella.
• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis, prostate and placenta. {ECO:0000269|PubMed:14652002}.
• Sequence:

  MGIVCAQCSFILLLSIIRARPPPFLFCPLSSQRTESPYKPVHLGLGPTDKVAAIAMARII
  DLVPWDDGSTHVYASPAILLPMERQRNQLAGVKQQLYHPALPTLRHMDRDTVKACLPDEH
  CQSTTYCRKDEFDNAHFTLLGVPNKPLQCLDITATGQKLRNRYHEGKLAPIAPGINRVDW
  PCFTRAIEDWSHFVSSAGEFKLPCLRKRAEGLSGYAVRYLKPDVTQTWRYCLSQNPSLDR
  YGQKPLPFDSLNTFRSFGSSYSRVNYLTPWH

• Sequence length: 271

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Crohn Disease	Crohn Disease	BEFREE	22467598		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22467598		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22467598	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31527446		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34001952	Associate	★☆☆☆☆ Found in Text Mining only