AREG (amphiregulin)

Gene

• Entrez ID: 374
• Gene name: Amphiregulin
• Gene symbol: AREG
• Synonyms (NCBI Gene): AR, AREGB, CRDGF, SDGF
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018541	hsa-miR-335-5p	Microarray	18185580
MIRT437742	hsa-miR-34a-5p	Microarray, qRT-PCR	22815788
MIRT437873	hsa-miR-200a-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437873	hsa-miR-200a-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT2435438	hsa-miR-135a	CLIP-seq
MIRT2435439	hsa-miR-135b	CLIP-seq
MIRT2435440	hsa-miR-34a	CLIP-seq
MIRT2435441	hsa-miR-34c-5p	CLIP-seq
MIRT2435442	hsa-miR-449a	CLIP-seq
MIRT2435443	hsa-miR-449b	CLIP-seq
MIRT2435444	hsa-miR-4729	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Repression	20103632
NFIL3	Unknown	1620116
SP1	Unknown	14742435

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	19740107, 30083275, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8702723
GO:0005615	Component	Extracellular space	IDA	12743035, 22184114
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	3413110
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	12743035
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	12743035
GO:0007267	Process	Cell-cell signaling	TAS	2466334
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2466334
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	12743035
GO:0009986	Component	Cell surface	IDA	12743035
GO:0010838	Process	Positive regulation of keratinocyte proliferation	TAS	2466334
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0014009	Process	Glial cell proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	8702723
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031175	Process	Neuron projection development	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0038134	Process	ERBB2-EGFR signaling pathway	IDA	8702723
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0048018	Function	Receptor ligand activity	IDA	8702723
GO:0048018	Function	Receptor ligand activity	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0060598	Process	Dichotomous subdivision of terminal units involved in mammary gland duct morphogenesis	IEA
GO:0060744	Process	Mammary gland branching involved in thelarche	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060750	Process	Epithelial cell proliferation involved in mammary gland duct elongation	IEA

Other IDs

• MIM: 104640
• HGNC: 651
• e!Ensembl: ENSG00000109321

Protein

• UniProt ID: P15514
• Protein name: Amphiregulin (AR) (Colorectum cell-derived growth factor) (CRDGF)
• Protein function: Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
• PDB: 2RNL
• Sequence:

  MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
  SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
  SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
  CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
  LRQENGNVHAIA

• Sequence length: 252

Pathways

KEGG:

MAPK signaling pathway
ErbB signaling pathway
PI3K-Akt signaling pathway
Hippo signaling pathway
Colorectal cancer

Reactome:

PIP3 activates AKT signaling
Signaling by EGFR
GRB2 events in EGFR signaling
GAB1 signalosome
SHC1 events in EGFR signaling
EGFR downregulation
COPII-mediated vesicle transport
EGFR interacts with phospholipase C-gamma
Constitutive Signaling by Aberrant PI3K in Cancer
Inhibition of Signaling by Overexpressed EGFR
RAF/MAP kinase cascade
Cargo concentration in the ER
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Extra-nuclear estrogen signaling
Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHROPOIETIC PROTOPORPHYRIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTOPORPHYRIA, ERYTHROPOIETIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC CREUTZFELD JACOB DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
46, XX Testicular Disorders of Sex Development	46, XX Gonadal Sex Reversal	BEFREE	9329414		★☆☆☆☆ Found in Text Mining only
46, XY Disorders of Sex Development	46, XY disorder of sex development	BEFREE	18391534, 20150575, 20583543, 21161538, 24186597, 25740850, 26197461, 27051040, 29051026, 29267169, 30064134, 30193409, 30815925		★☆☆☆☆ Found in Text Mining only
5-Alpha Reductase Deficiency	5-alpha reductase deficiency	BEFREE	20132346, 6480803		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	19218788, 22829074, 31249215, 31251549		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	19218788, 22829074, 31249215, 31251549		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	23354516		★☆☆☆☆ Found in Text Mining only
Acquired porencephaly	Acquired Porencephaly	BEFREE	16061602		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	30395538		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	20670477		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11850546		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23798432		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11145738, 11161850, 11712819, 11880592, 12115497, 12445232, 14716741, 1552612, 15665279, 18007998, 18481268, 19318631, 20587701, 21432867, 21454516, 22471922, 23362007, 24374738, 24879567, 26700622, 26855148, 27072221, 27440270, 27545006, 27634876, 27689328, 28593420, 28859123, 28900498, 29396873, 29851094, 29851704, 29981816, 30337589, 31013476, 31428578, 31434729, 31565603		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15665279		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11712819, 26467701, 29052817		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	1457126, 24879567, 30628926		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	12445232, 12534363, 12837460, 1457126, 15661808, 19318631, 19670238, 21432867, 22389383, 23402539, 27072221, 27180064, 28108419, 29530944, 29605661		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	BEFREE	29385707, 31495607		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10623680, 1596904, 18228161		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	31522216		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	BEFREE	28544044		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11856748, 18227724, 30620391		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	27267807		★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	24884994	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	31759122		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	31759122	Associate	★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25409505		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	30926306		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	10711573, 11231320, 12670719, 15824176, 17256155, 20233794, 21061765, 23955654, 27304862		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	CTD_human_DG	15902657		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	11231320, 15824176, 15902657, 16115056, 16172040, 17256155, 18849991, 19340294, 19373488, 19538365, 20426708, 20450840, 21073542, 21352305, 21410621, 21981665, 22829074, 23479164, 23955654, 24244503, 24665929, 26178169, 29549490, 30019525, 31217429, 9677254		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	15902657		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASDB_DG	22693459		★☆☆☆☆ Found in Text Mining only
Alpha-Methylacyl-CoA Racemase Deficiency	Alpha-Methylacyl-CoA Racemase Deficiency	BEFREE	29138507		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	26817844		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23545426	Associate	★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	BEFREE	10485299, 10543676, 10711573, 12638777, 15925895, 16705072, 29022558, 9607727		★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	17852420, 20672904, 37346838	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	11719252, 16358333, 20840067, 22233359, 24630363, 25889790, 30849180, 7515106, 8400860, 9268245		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22179855		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	31031857		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	10404311, 10428170, 10458483, 10617653, 10840043, 11144509, 12682377, 12801411, 1426313, 1430233, 15724799, 15812177, 1609793, 16365032, 16400085, 165510, 16759930, 16950754, 17522416, 176660, 17714709, 17852420, 17945006, 18097502, 18097504, 18270433, 18342859, 18978937, 19023143, 19330472, 19463997, 1999491, 20011049, 20056211, 20150575, 20198568, 20305676, 20410220, 20888558, 20971460, 21050150, 21311178, 21710452, 22334658, 22653923, 22812659, 22829593, 23106833, 23744686, 23841731, 24023855, 24186138, 24186597, 24302751, 2594783, 25997614, 26592841, 26778393, 26845730, 27087292, 27110943, 27267075, 27403927, 27583472, 27609317, 28611373, 28659371, 29118296, 29396419, 29785970, 30113450, 30401990, 30787207, 31012339, 31393562, 31401253, 31429517, 31671693, 31822498, 3186717, 32338288, 32345305, 32497951, 32505105, 32694570, 33182400, 33602557, 33723169, 33750429, 33863387, 34233262, 34670306, 34833359, 35051551, 35163481, 35447082, 35732329, 35974208, 36806291, 36852701, 36921044, 37148822, 37346838, 38212646, 3872888, 39394131, 500829, 6323534, 6333813, 6602545, 7649349, 7926115, 7937057, 7951549, 8099270, 8128958, 8174721, 8224266, 8253718, 8450042, 8574287, 8647313, 8980896, 9016528, 9039995, 9576916, 9610419, 9895128	Associate	★☆☆☆☆ Found in Text Mining only
Androgen Receptor Deficiency	Androgen-Insensitivity Syndrome	CTD_human_DG	1303262, 8281139		★☆☆☆☆ Found in Text Mining only
Androgen Receptor Deficiency	Androgen-Insensitivity Syndrome	BEFREE	30041870, 6748013		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	UNIPROT_DG	10022458, 10221692, 10221770, 10404311, 10458483, 10571951, 10590024, 10690872, 11587068, 11744994, 1307250, 1316540, 1426313, 1430233, 1464650, 14756668, 1480178, 1487249, 1569163, 1609793, 16129672, 16595706, 1775137, 1999491, 2082179, 2594783, 7537149, 7581399, 7633398, 7641413, 7671849, 7929841, 7962294, 7970939, 7981687, 7981689, 7993455, 8040309, 8096390, 8103398, 8162033, 8224266, 8281140, 8325950, 8339746, 8413310, 8446106, 8626869, 8647313, 8683794, 8723113, 8768864, 8809734, 8830623, 8918984, 8990010, 9001799, 9007482, 9039340, 9106550, 9160185, 9252933, 9255042, 9302173, 9328206, 9544375, 9554754, 9610419, 9627582, 9698822, 9851768, 9856504		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	10079022, 10221692, 10458483, 10470409, 10485299, 10502786, 10571951, 10690872, 10965214, 10971094, 10999818, 11238515, 11260228, 11282274, 11380707, 11587068, 11595828, 11684838, 11744994, 12006704, 12213902, 12466388, 12519373, 12573815, 12682377, 12705360, 12713250, 12801411, 12843171, 12898143, 1307250, 1347772, 1356901, 1426313, 14605819, 14635106, 1472458, 1480178, 14974091, 15053245, 15118070, 15171708, 15452386, 15486055, 15522944, 15705293, 15812177, 15919721, 15925895, 16118342, 16283146, 16470553, 16759930, 17077943, 17408421, 17875488, 17937062, 17970778, 18097502, 18097504, 18270433, 18577874, 18694860, 18697867, 18844449, 19010817, 19178528, 19330472, 19844078, 19851057, 20011049, 20056211, 20198568, 20333878, 21501000, 21778211, 21796517, 21871529, 21950590, 21962961, 22334387, 22334658, 22469007, 22487869, 22653923, 22799610, 22812659, 22829593, 22909003, 23044881, 23637914, 23774508, 23808476, 24023855, 24055831, 24186597, 25034089, 25354046, 25401426, 25500996, 25721709, 26197461, 26303084, 26592841, 26688387, 27267075, 27583472, 28165461, 28261839, 28545802, 28624954, 2885254, 29051026, 29237170, 29267169, 29393262, 29740819, 29785970, 30041870, 30113450, 30124873, 30165367, 30193409, 30449224, 30742848, 31351520, 31401253, 31429517, 3186717, 3447937, 6748013, 6833492, 7489816, 7551823, 7581399, 7626493, 7909256, 7910529, 7920176, 7970939, 7981687, 8096390, 8126121, 8205256, 8224266, 8240973, 8325932, 8325950, 8421085, 8733002, 8823308, 8864743, 8867071, 8918984, 9039340, 9039995, 9156036, 9160185, 9302173, 9328206, 9360511, 9519369, 9544375, 9554754, 9607727, 9642623, 9768671, 9788719, 9838248, 9856504		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	CLINVAR_DG	10092153, 10425033, 10458483, 10690872, 10834333, 11376111, 11788616, 11788673, 12843171, 1307250, 1430233, 1458719, 14974091, 15531547, 15541764, 15925895, 1598912, 16083860, 16365032, 16450583, 17054461, 19463997, 20011049, 20150575, 20493947, 2082179, 2332504, 24737579, 25241384, 25248670, 25613104, 26778393, 26980296, 27267075, 27899157, 28186600, 28261839, 28624954, 7671849, 7981689, 8040309, 8126121, 8723113, 8824883, 9039340, 9328206, 9768671, 9856504		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	LHGDN	11818512, 11889162, 12213902, 12465595, 14974091, 15046097, 15053245, 15171708, 15919721, 16373394, 16470553, 16759930, 16950754, 17538927, 17714709, 17937062, 18270433, 18462702, 18694860		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	CTD_human_DG	1303262, 8281139		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	15824176, 15902657, 16115056, 17256155, 17596176, 18849991, 19340294, 19373488, 19538365, 20233794, 20426708, 21073542, 21167691, 21352305, 21410621, 21981665, 22309448, 22829074, 23479164, 23955654, 24244503, 24352509, 24665929, 26178169, 28912032, 29254307, 29549490, 30811143, 31217429, 9677254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	15902657		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	30325657		★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	24201121		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	10852984, 23441776		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24520077, 30123360, 30154150		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	19656574, 21883946		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19656574, 21883946		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	28158988	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	26817611		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31413553	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	21119710, 26817611, 28041593, 28626075		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	10987273, 11085509, 11327116, 12659682, 12890669, 14581372, 15604291, 15808955, 16081517, 1609793, 16423882, 16637076, 16639715, 16647340, 16685399, 16707435, 16763722, 16932916, 16980632, 17476687, 17483314, 17653089, 17909037, 18037965, 18273831, 18383880, 18668523, 18798265, 18800375, 18845648, 19062173, 19095061, 19155198, 19266268, 19289629, 19353593, 19514049, 19585490, 19635783, 19638585, 19672785, 19684615, 19737972, 20140206, 20210997, 20478527, 20587701, 20628607, 20709811, 20812024, 21117024, 21130868, 21212260, 21308717, 21310825, 21328348, 21393425, 21426013, 21437722, 21454491, 21539745, 21606347, 21613411, 21799031, 21820046, 21870073, 21956922, 21971318, 22194926, 22266859, 22281759, 22282656, 22289337, 22391564, 22592999, 22597536, 22710436, 22745190, 22922989, 22971343, 22986532, 23023561, 23033951, 23095762, 23130941, 23171135, 23172223, 23257359, 23307762, 23363071, 23386686, 23447569, 23449888, 23451058, 23493267, 23500889, 23523566, 23536649, 23568956, 23576568, 23658830, 23661605, 23715826, 23723256, 23752182, 23780684, 23792449, 23873027, 23906537, 23989930, 24037531, 24086346, 24129850, 24169353, 24177177, 24258347, 24375805, 24466341, 24478054, 24519926, 24565564, 24681825, 24727738, 24759320, 24837363, 24942741, 24948870, 24948871, 24948876, 24956378, 24970477, 25048254, 25107669, 25135278, 25148265, 25241147, 25327559, 25447311, 25500144, 25537508, 25552366, 25592066, 25631336, 25752515, 25799006, 25846647, 25889790, 25908644, 25920548, 25934687, 25965833, 25965834, 26056150, 26093899, 26152357, 26152593, 26187127, 26229034, 26257066, 26267320, 26294211, 26322830, 26331358, 26336819, 26342199, 26346258, 26443432, 26493122, 26554309, 26563462, 26658102, 26806347, 26907477, 26939703, 26940039, 26944953, 26960690, 26988939, 26993046, 27120785, 27174161, 27196763, 27238081, 27264242, 27274052, 27276681, 27325180, 27330033, 27342777, 27375016, 27634452, 27659047, 27689328, 27720870, 27729622, 27741508, 27741511, 27753448, 27760825, 27794047, 27799360, 27848972, 27874061, 27897170, 27909718, 27959439, 27993966, 28050800, 28064545, 28069826, 28085048, 28087386, 28105499, 28117763, 28174422, 28220803, 28252832, 28257035, 28264478, 28275218, 28302679, 28361223, 28386843, 28411207, 28420128, 28428441, 28430389, 28439009, 28474805, 28485785, 28507054, 28597850, 28604629, 28624514, 28652170, 28668854, 28671964, 28692046, 28724614, 28860512, 28916342, 28916652, 29017058, 29033586, 29038335, 29119053, 29131020, 29138500, 29147906, 29210989, 29243324, 29269934, 29316842, 29346310, 29366632, 29388326, 29395951, 29431615, 29449534, 29453314, 29456113, 29523594, 29530945, 29555663, 29556062, 29568063, 29577611, 29588330, 29592878, 29609138, 29616091, 29618577, 29686105, 29716963, 29720561, 29734647, 29748904, 29749458, 29764864, 29808619, 29859188, 29880907, 29917167, 29934670, 29944905, 29956684, 29990947, 29991699, 30037818, 30042415, 30054487, 30058677, 30084432, 30118330, 30125354, 30197098, 30223929, 30224543, 30228209, 30230528, 30250564, 30257470, 30305646, 30306781, 30345525, 30395538, 30396917, 30565725, 30578319, 30602500, 30626088, 30642743, 30655535, 30667363, 30763921, 30773341, 30774773, 30848157, 30853652, 30864720, 30913537, 31006613, 31012142, 31027362, 31043708, 31068457, 31077419, 31110275, 31181727, 31217781, 31221168, 31239713, 31243151, 31260412, 31308078, 31310591, 31337771, 31344408, 31357527, 31404966, 31434793, 31445027, 31477836, 31527644, 31574376, 31578588, 31629421, 31636720, 31664946, 31752909, 31762940, 31783154, 31804970, 31814621, 31838085		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	BEFREE	31213383		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	7772520		★☆☆☆☆ Found in Text Mining only
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	BEFREE	8980896		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15536156, 24688120, 28626075		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22251404		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10419869, 22040886, 27355582, 30407753	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17082220	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	15186320		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	15186320		★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	30485184		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	21356322		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15696081, 15696083, 19447920, 20414053, 21036386, 22247333, 28137591, 30972065, 31299143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15696081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	15696081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26047642, 31299143	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	33779531	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31031857		★☆☆☆☆ Found in Text Mining only
Asymmetric crying face association	Asymmetric crying face association	BEFREE	10866306		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	24913494	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	26336104		★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	20621188, 24816443		★☆☆☆☆ Found in Text Mining only
Ataxias, Hereditary	Ataxia	BEFREE	10838245		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15536156, 24688120, 28626075		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	37505165	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	24789081, 31604846, 34784541	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	BEFREE	21988129, 7852512		★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrophy, Muscular, Spinobulbar	Spinobulbar Muscular Atrophy	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	19167832, 26910733	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19167832, 26781567, 26910733		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	16167093, 19132145, 19167832, 23801657, 26742492		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	19167832		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	19167832, 23801657, 26742492	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21445561, 22466402, 27072778, 28593345		★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	25047668	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	10604712, 10999818, 12042281, 12220434, 1750490, 17919607, 27498682, 28659371, 29228103, 29441603, 31373714, 7926115, 9851768		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	11172827, 12399527, 12634316, 17919607, 19168451, 23884765, 24919724, 28659371, 40215689, 7926115	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	27089915	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	17919607, 27089915		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28953224		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23625463		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	23625463	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10221569, 10544298, 10589774, 10705205, 12845678, 14619959, 14654929, 14742287, 15136785, 16039774, 17979523, 18217192, 18471792, 18495332, 18675615, 19938041, 21454491, 21620560, 22562653, 22653589, 22731640, 22765868, 23184046, 23609189, 24634161, 24665929, 24812058, 25277659, 26677878, 26709083, 27072221, 27197599, 27594448, 27880726, 28694768, 28830494, 28953224, 29133842, 29441606, 29568063, 29756415, 30028845, 30061836, 30124113, 30724641, 31467577, 31489669, 31591335, 31797688, 8608963, 9092797, 9886600		★☆☆☆☆ Found in Text Mining only
bilateral breast cancer	Breast Cancer	BEFREE	19875753		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	35774294	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	20200439		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	20200439	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15302512		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17406000, 22218302, 22608749, 22922989, 23330817, 23447569, 24126741, 24329492, 24662746, 26229034, 26264279, 26342199, 26862755, 27196763, 27330033, 27909718, 28064545, 28241422, 28342317, 28362839, 28869948, 29119053, 29592878, 29659560, 29720561, 29731413, 29964053, 30573691, 30864720, 30961575, 31006613, 31110275, 31119584, 31234917, 31506605, 31574376, 31803932, 31843555		★☆☆☆☆ Found in Text Mining only
Blind vagina	Blind vagina	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	8592334		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	28144969		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	32692888	Associate	★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	35432193	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19257827	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28166157, 31712765		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	34468540	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	20465808	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	28467804, 35231560	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19622585, 28467804, 32366278	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	31031857		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	12124798		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	21159020		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10070897, 10205268, 10359549, 10509795, 10545416, 10711573, 10717532, 10817350, 11005214, 11085509, 11139248, 11208351, 11237771, 11368874, 11437399, 11479228, 11494130, 11532875, 11673900, 11768600, 11861380, 11862478, 11867264, 11927493, 12124798, 12404104, 12582022, 12866037, 1303262, 14504193, 14973115, 15544494, 15545219, 15609126, 15625768, 15743497, 15772083, 15827323, 16099479, 16166329, 16317584, 16365023, 16457685, 16791593, 16987421, 17127330, 17187234, 17241382, 17363371, 17429562, 17431821, 17465263, 17631997, 17670913, 17728127, 17850661, 17855696, 17882547, 17904846, 18381432, 18398673, 18437539, 18497066, 18521741, 18562955, 18686047, 18949710, 19276248, 19533338, 19638585, 19840198, 19898421, 20103632, 20208479, 20353269, 20431938, 20605569, 20651357, 20697807, 20814820, 20831839, 20846920, 20947401, 21107681, 21109569, 21159020, 21166701, 2142871, 21528410, 21532617, 21552212, 21741601, 22021428, 22033271, 22321971, 22348324, 22445895, 22471922, 22494987, 22719059, 22745190, 22747683, 22792352, 22825057, 23023562, 23272232, 23377847, 23392859, 23418309, 23460808, 23530127, 23846226, 23889773, 24068959, 24172884, 24324816, 24356815, 24552459, 24570075, 24581183, 24951107, 25001242, 25072326, 25178514, 25178713, 25230018, 25310144, 25447311, 25454348, 25510351, 25695063, 25722318, 25723113, 25781993, 25904752, 25907805, 25979597, 26051240, 26076967, 26201402, 26219822, 26341737, 26345963, 26385458, 26406407, 26487496, 26541420, 26552477, 26554309, 26694952, 26730581, 26803986, 26902145, 26938985, 27052658, 27340922, 27434295, 27494865, 27496708, 27514395, 27528625, 27548161, 27721402, 27793424, 27796944, 27893717, 27959398, 28060723, 28067809, 28106301, 28134791, 28151718, 28208703, 28216130, 28301631, 28359301, 28364216, 28404691, 28443693, 28468774, 28570747, 28643022, 28741260, 28766215, 28785183, 28814476, 28816390, 28915724, 28916342, 28918115, 28957377, 28974548, 29053266, 29059676, 29069648, 29078133, 29085503, 29109513, 29131020, 29180246, 29187427, 29187464, 29237712, 29254284, 29340907, 29342868, 29353883, 29373071, 29386247, 29423076, 29453314, 29514843, 29578828, 29587674, 29651273, 29662164, 29699584, 29707142, 29713287, 29802469, 29843115, 29844843, 29890379, 29912871, 29969155, 29970021, 30109519, 30208359, 30210453, 30232143, 30254080, 30254184, 30279965, 30293951, 30367629, 30406874, 30416486, 30445651, 30468800, 30520109, 30547831, 30557851, 30577860, 30594038, 30606771, 30628666, 30745839, 30795773, 30821186, 30869771, 30941159, 30941650, 31002873, 31004257, 31077689, 31110518, 31125586, 31126320, 31207361, 31289138, 31297554, 31367790, 31434793, 31603099, 31664946, 31693255, 31728025, 31749246, 31822498, 31838731, 7489816, 7649107, 7748811, 7749138, 7792809, 7920176, 8018407, 8101763, 8180021, 8541881, 8695152, 8784104, 8880869, 8959346, 9075695, 9259393, 9537231, 9886853		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	11237771, 21633166, 22174584		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	37549632	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10205268, 11005214, 11437399, 11862478, 14973115, 15625768, 15743497, 15772083, 16457685, 16567872, 16791593, 16977795, 16987421, 17218988, 17363371, 17465263, 17591970, 17670913, 17882547, 17942395, 18275596, 18381432, 18383828, 18507821, 18516291, 18794799, 18951974, 19147544, 19383315, 19840198, 19875753, 19887463, 19898421, 19921427, 20103632, 20421209, 20507730, 20846920, 21109569, 21302279, 21310761, 21325075, 21552212, 21701558, 21812955, 22033271, 22154362, 2229140, 22321971, 22471922, 22747683, 22792352, 22825057, 22825604, 23023562, 23272232, 23289893, 23392859, 23530127, 23582599, 23605249, 23663520, 23844004, 23846226, 23929266, 23965901, 24403250, 24433040, 24570075, 24581183, 24591826, 24850180, 24996432, 25140630, 25160502, 25178514, 25447311, 25471060, 25510351, 25743329, 25781993, 26051240, 26195282, 26230371, 26339363, 26385458, 26487496, 26541420, 26552477, 26554309, 26694952, 26711786, 26742006, 26757422, 26862856, 26965862, 27015557, 27052658, 27120467, 27285752, 27340922, 27434295, 27514395, 27565181, 27959398, 28035996, 28060723, 28272969, 28359301, 28443693, 28643022, 28912144, 28957377, 29053266, 29059676, 29131020, 29353883, 29386247, 29587674, 29699584, 29912871, 29970021, 29991699, 30351863, 30406874, 30445651, 30547831, 30577860, 30591548, 30606771, 30795773, 30805773, 30899086, 31059536, 31151151, 31427547, 31603099, 31664946, 31684907, 31718606, 31728025, 31822498, 31891807, 32102539, 32374753, 32928183, 32948192, 33112819, 33184106, 33294922, 33348168, 33534004, 33591468, 34016642, 34159849, 34593966, 34864989, 35379053, 35618789, 36097802, 36182805, 36232774, 36450882, 36469363, 36508355, 36641656, 36826464, 37244387, 37264265, 37438515, 37460990, 37846186, 37903548, 38003261, 38427749, 39256855, 39769441, 39978376, 40616536, 8180021, 8413317, 8663058, 8883401, 9399843, 9703283	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18949710, 24552459, 33660830	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	10070897, 10617653, 14680496, 21505847, 22142662, 23272232, 27003765, 29092024, 29396493, 30577860, 36494460, 500829	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms, Male	Neoplasm of male breast	CTD_human_DG	1303262, 8281139		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	19447920		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis obliterans	Pubtator	24816162	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	27545006		★☆☆☆☆ Found in Text Mining only
Bulbar palsy	Bulbar palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	CLINVAR_DG	10092153, 10425033, 10458483, 10690872, 10834333, 11266016, 11376111, 11788616, 11788673, 12843171, 1307250, 1430233, 1458719, 14974091, 15531547, 15541764, 15925895, 1598912, 16083860, 16365032, 16450583, 17054461, 19463997, 20011049, 20150575, 20493947, 2082179, 2332504, 24737579, 25241384, 25248670, 25613104, 26778393, 26980296, 27267075, 27899157, 28186600, 28261839, 28624954, 7671849, 7981689, 8040309, 8126121, 8723113, 8824883, 9039340, 9328206, 9768671, 9856504		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	10398229, 10400640, 10434308, 10486315, 10495104, 10643885, 10717003, 10838245, 10899444, 11420135, 11422120, 11501969, 11684838, 11719252, 11719253, 11719263, 12165558, 12221177, 12372280, 12393801, 12445917, 12481545, 12657679, 12824190, 12962912, 12968071, 1303195, 1303283, 1436532, 14526186, 1461383, 1469423, 14698481, 14999487, 15003169, 15116379, 15133611, 1513460, 15151675, 15152038, 15609126, 15659427, 15830083, 15851746, 15876692, 15978183, 16079302, 16260738, 16358333, 16388114, 16621916, 16644868, 16751763, 16772330, 16793767, 17122035, 17185503, 1734865, 17359355, 17364438, 17494697, 17596176, 17852020, 17854832, 17984450, 18056738, 18586675, 18642379, 18775514, 18824496, 18844449, 19237573, 19259967, 19279159, 19399234, 19679072, 19965845, 20336775, 20410122, 20621188, 2062380, 20826791, 20840067, 20846673, 20869592, 21284948, 21317158, 21745497, 22158719, 2222245, 22233359, 22366762, 22476656, 22609045, 22660636, 22668795, 22720173, 22736030, 22829593, 23024039, 23364790, 23420040, 23560310, 23637164, 23644820, 23679084, 23719921, 24040817, 24150846, 24742452, 24742458, 24746732, 24759840, 24816443, 24894177, 25047668, 25122660, 25168383, 25182772, 25392924, 25569348, 26363965, 26453288, 26490709, 26563449, 26572535, 26576772, 26614347, 26755334, 26872663, 26971100, 27141859, 27276254, 27984179, 28087734, 28117338, 28395737, 28473226, 28511915, 28596723, 28688959, 28780536, 28972672, 29102238, 29137918, 29427100, 29464380, 30006721, 30148479, 30391288, 30612224, 30644418, 30847645, 30886222, 31048691, 31310754, 31351215, 31481932, 31537808, 31551920, 31686397, 7489816, 7515106, 7595622, 7626493, 7702080, 7757084, 7852512, 7870107, 7920176, 8065934, 8170488, 8187377, 8252045, 8400860, 8469342, 8710782, 8737374, 8867071, 8867072, 8872464, 8926495, 8946111, 9010714, 9129739, 9177411, 9211187, 9217976, 9268245, 9384612, 9437788, 9466993, 9554754, 9580659, 9642623, 9708548, 9813160		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Bulbospinal Neuronopathy	Bulbospinal Neuronopathy	BEFREE	11684838, 1436532, 20846673, 2222245, 31351215, 8187377		★☆☆☆☆ Found in Text Mining only
Bulbospinal Neuronopathy	Bulbospinal Neuronopathy	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Bulbospinal neuronopathy, X-linked recessive	Bulbospinal Neuronopathy, X-Linked	BEFREE	10510685, 1449253, 7477059, 7699390, 8158210		★☆☆☆☆ Found in Text Mining only
Bulbospinal neuronopathy, X-linked recessive	Bulbospinal Neuronopathy, X-Linked	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	11502837		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31005169	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	14691288, 17935158, 18708348, 18762779, 20634343, 23576568, 23922223, 24634161, 24694733, 25409505, 26876983, 27587619, 27606620, 28826481, 32879302, 35456428	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11278645, 19840198, 20098441, 22922989, 23041672, 23272232, 24207095, 25315188, 25781993, 25943311, 30367117, 30509050, 30577860, 31772120, 31978895, 32574835, 37817274, 37838724, 38182647, 38212646	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37806457	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10426191, 10589774, 10884916, 11061898, 12429819, 1552612, 15663988, 1591731, 17217995, 17277772, 17925854, 19305383, 19433513, 22491422, 23715826, 26890396, 27730305, 28582344, 30099587, 30267779, 30293951, 30464211, 30677079, 7558427, 7712463, 7971517, 8087144, 8407551, 8628719, 9000575, 9076469, 9648926, 9731888, 9735408		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15154665	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	20027446, 30382367	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33797847	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35552660	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	18508419, 21109569, 23605249, 30570854, 39666421	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25588857	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	11825917, 17465263, 30284987	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29210800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	32583986, 40186889	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17191310, 18768969, 19337692, 20049203, 22819717, 23285165, 23594797, 23620780, 24586606, 24860833, 25217983, 28351301, 29144509, 31685543, 31759122, 32548867, 32579541, 33118329, 33328560, 34664394, 37181805, 38182647	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21642359, 25048477, 40010639, 9288632	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11825917, 18043578, 21109569, 29193395, 32928183, 35933669	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	31989433	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25837163	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	20027446	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	29385707, 29419396	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17406000, 20127024, 22218302, 22608749, 22922989, 23330817, 23447569, 24126741, 24329492, 24662746, 26229034, 26264279, 26342199, 26862755, 27196763, 27330033, 27909718, 28064545, 28241422, 28342317, 28362839, 28869948, 29119053, 29592878, 29659560, 29720561, 29731413, 29964053, 30864720, 30961575, 31006613, 31110275, 31119584, 31234917, 31506605, 31574376, 31803932, 31843555		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12558872, 18692155, 20035825, 20127024, 27783866, 28476786, 29112457, 29915882, 30096292, 31426812		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	10070897, 10221692, 10617653, 11139248, 12602915, 14555518, 15609126, 20625818, 21505847, 22017761, 23272232, 26276719, 28062545, 29478945, 29802469, 30267249, 30577860, 30941241, 7920176, 8281139, 8784104, 9220020, 9537231		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	CTD_human_DG	1303262, 8281139		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	11572759, 26556855, 28467804, 32366278, 32718331, 34321053	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21614520	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24520077, 27391842	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26814892, 31427547, 31759122, 33797847, 35452181, 37563650, 39336758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33817721	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	21336263	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	32649013	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10622536, 12743035, 22491422, 32859636, 32991423	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	34784541	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10601543, 17284955		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	28582344		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	20587701		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10050867, 10706107, 10925355, 11221880, 11572759, 11956643, 12404104, 14506156, 15545219, 17372242, 17825390, 18374401, 19623182, 19818997, 22001143, 26410037, 26556855, 26768617, 27741511, 27835572, 28250337, 28459431, 28467804, 29716628, 30791431, 30986993, 31495455		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	21482691		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	28582344		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	23631840		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	11561770, 11562768, 21109569, 23631840, 25230018, 25837163		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28374812		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	16401639, 31803623		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	22986532, 33563753	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	35231560	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	23468366, 28626075, 28854881, 30249407, 30610589, 31213383		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30137189, 30957588, 9288632		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30137189		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30137189, 30957588, 9288632		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19447920		★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Childhood Ganglioglioma	Ganglioglioma	BEFREE	17259542		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25409505		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31978895, 35449153	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	20200439		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	17241382, 20200439		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	20938960		★☆☆☆☆ Found in Text Mining only
Chondroma	Chordoma	Pubtator	34468540	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	25825984, 27826039, 30230033, 30790501		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	30790501, 37928274	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	17074594		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	LHGDN	17074594		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	31092430		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	30633606		★☆☆☆☆ Found in Text Mining only
Chronic mountain sickness	Mountain sickness	BEFREE	25277225		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	9929111		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28137591		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30888496		★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Cirrhosis	Pubtator	12427778	Associate	★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	29108248		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	26845730, 34646402	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31844181		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23333074, 30171165		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30425334	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10362109, 11120331, 11297235, 1591731, 16365013, 1639855, 16425262, 1715580, 29682205, 7558427, 9335455		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	1639855, 16886596, 25301365	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16425262, 16685431, 1715580, 19062046, 21206494, 22409860, 23374602, 24114668, 24520077, 25376484, 25637315, 25644309, 27267075, 27272216, 27344184, 30252132, 31176300, 31519572, 31522216, 31557860, 8519646		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10362109, 14742435, 19558693, 20977730, 21283802, 22409860, 23374602, 24520077, 24916700, 25644309, 25707609, 26569500, 27272216, 30804124, 31522216, 33906293, 37363997	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	1596904, 1715580		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	31341110		★☆☆☆☆ Found in Text Mining only
Complete androgen insensitivity syndrome	Complete Androgen Insensitivity Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	10380986		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	30810814		★☆☆☆☆ Found in Text Mining only
Congenital absence of vas deferens	Absent vas deferens	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	12050225, 1306840, 20631003, 24907477, 28613048		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	LHGDN	12050225		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	18618087, 20233785, 25230321, 26848581		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	26848581	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10797498, 15452386, 17485299, 17720778, 3106395, 7529041		★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	BEFREE	19139660		★☆☆☆☆ Found in Text Mining only
Congenital phimosis	Congenital Phimosis	BEFREE	22218452, 23386417		★☆☆☆☆ Found in Text Mining only
Congenital porencephaly	Congenital Porencephaly	BEFREE	16061602		★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	24469092	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23460808, 25796113, 26304926, 26814892, 26973243, 27848972, 28089832, 28107702, 28253524, 28644440, 29030639, 29108248, 29572225, 30919276, 31000693, 31110275, 31759122		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14974917, 15890890, 21712734, 25716092, 29483579, 31794514		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	14974917, 21712734, 25716092		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	15536156		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25716092, 30193537	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	26097556	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	14974917, 15890890, 21712734, 25716092		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	11524144		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	25990246	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	11044458, 11591424, 15472213, 15757859, 16566985, 16813680, 17945479, 18436703, 22188741, 22906643, 26122119, 29044734, 29914823, 30568634, 9720578		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	LHGDN	15472213		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	16813680, 16957138, 22906643, 37377277	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	12139632		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	19954814, 28059101		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	25070172	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18026571, 29351448		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18026571, 30598261, 35412656	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	30939080		★☆☆☆☆ Found in Text Mining only
Deficiency of testosterone biosynthesis	Deficiency Of Testosterone Biosynthesis	BEFREE	15638871, 17197074, 23589523, 24480924, 28359094, 31642815, 31731497		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16098017, 17082220, 20131243		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	26633815		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	10085113, 12042281, 24816443, 8926495		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11543741, 15817010, 17178554, 17945479, 19656574, 20808127, 21883946, 23602133, 27108772, 28096796, 28447621, 31480771, 7971517		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19656574, 20808127, 21883946, 23602133, 24269497		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	28447621	Associate	★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	12139632		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	22829074, 28655741, 28912032, 29632822, 8739992, 9677254, 9804327		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	10732754, 17077595, 23035734	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24058525, 25974321, 27289045, 28994096, 29249638, 30261555		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24058525, 25974321, 27289045, 28994096, 29249638, 29295509, 30261555, 30729682		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29249638	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30113450	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29249638	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14641003		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18805913, 21470285, 24165020, 28673384, 29249638, 29925687, 30601759		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Disorder of Sex Development 46 XY	46, xy disorder of sex development	Pubtator	18342859, 20056211, 20150575, 20198568, 20410220, 22909003, 24186597, 26778393, 32985417	Associate	★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	20150575, 22909003, 24186597, 25047668, 27583472, 29022558, 31429517, 33182400, 33750429, 34233262, 34833359, 35135181	Associate	★☆☆☆☆ Found in Text Mining only
Dowling Degos Disease	Dowling degos disease	Pubtator	21356322	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	12114274		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29082243		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	30367629, 31603099, 7749138		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	11853085	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	18273818		★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	9310472		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	9310472	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19159685, 21470285, 30153063		★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	30568634		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	30395538		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	18805913		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	37346838	Associate	★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	26888452		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	18978937, 21949845, 25296973, 26918604, 29773186, 33822745	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	33112819	Stimulate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	8421085		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	7856759		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10708486, 11074602, 11571732, 12115497, 12767946, 12873984, 15721279, 16161040, 16187285, 19190146, 20053928, 25231075, 26397136, 28071680, 28277313, 28540420, 28582344, 28782227, 31256208		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	12115497, 30745857		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	17465263, 30745857, 9916939	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12115497, 12767946, 15721279, 16187285		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18334972, 19190146, 19775474, 20053928, 23962788, 27384477, 28071680, 28782227, 29747687, 31256208, 32583986, 37725629, 39205690, 39326337, 40186889, 7856759	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26930451	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	28114189, 29869299		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20063560, 26134036, 29664547, 36860677	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	20190557, 26134036, 7805924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	21614520	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	BEFREE	10029594		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	11044578		★☆☆☆☆ Found in Text Mining only
Epispadias	Epispadias	BEFREE	20641097		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10925355, 11572759, 17825390, 18374401, 22001143, 26410037, 26556855, 28467804, 30986993		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	16741972		★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	18188596, 20633799		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	26216079, 30729682		★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	26216079, 30333254, 37551851	Associate	★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	CTD_human_DG	19267999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11297235, 11712819, 12925954, 25724186, 27801498		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11297235, 12925954, 25724186		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	12925954		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25724186	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25724186	Stimulate	★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	11768600		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	21283802	Associate	★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	8863165		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	14654929, 19244107, 23012352, 24375805, 28052297, 30367117		★☆☆☆☆ Found in Text Mining only
Familial Motor Neuron Disease	Motor Neuron Disease	BEFREE	16358333, 19259967, 19399234		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	29052817		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	10537180		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	10537180		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	25744849, 30523261		★☆☆☆☆ Found in Text Mining only
Female Pseudohermaphroditism	Female Pseudohermaphroditism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ferrochelatase deficiency	Ferrochelatase Deficiency	CTD_human_DG	19267999		★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	17465263		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	10690175, 20846920	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	15704521, 20951201, 26342051, 8049142, 9176406		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15704521, 18601603		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	23035734, 9060600		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18634036		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	22386953		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	10537180		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24009453	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	17259542, 9250169		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31759122		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	11859273		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	LHGDN	11859273		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	24520077	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19298600		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	19298600	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	15466379, 23958352	Associate	★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Genital Diseases, Male	Genital Diseases	CTD_human_DG	25434310		★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	31110275		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	10221692, 10428170, 12629412		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	12139632		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	15223968		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23624749, 25315188, 29731997, 30778332, 31759122, 9796995		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25315188, 31370819, 34681618, 35633167, 35661403, 36361793, 38233838	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31759122, 36235203	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23624749, 25315188, 29731997, 31370819, 31759122, 9796995		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28423563, 9796995		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28423563, 31759122, 39333688	Associate	★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis	Gonadal Dysgenesis	BEFREE	11808880		★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, 45,X	Gonadal Dysgenesis	BEFREE	9176406		★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, Mixed	Gonadal Dysgenesis	BEFREE	31180485		★☆☆☆☆ Found in Text Mining only
Gonadoblastoma	Gonadoblastoma	BEFREE	12106750		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35116032	Associate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	30425334	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31393854	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35224759	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29038366		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	25297715, 30833441		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	18273818, 20465808	Associate	★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	15541764, 22412043, 2370295, 25401426, 26901084, 27087292, 29802469, 7852512		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	21532617		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	14693242, 19843672		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	15342401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	17321486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	16918952, 23679084, 27289045, 28619364		★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	30193537	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	8637249, 9479867		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	24793825		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	19302446, 37145012	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia b	Pubtator	9233568	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	23468366	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21552212	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	24391916	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	10717532, 11368874		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22471922, 22825604, 23929266, 24850180, 35134468, 36916425	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24570075	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15723263, 15940630, 16367923		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	22385118		★☆☆☆☆ Found in Text Mining only
Hereditary liability to pressure palsies	Hereditary Liability To Pressure Palsies	BEFREE	29137918		★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	10470409		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	20819448, 7510816		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10583270, 14519624		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	19825997		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10639135, 11356158, 18586675, 18844449, 20621188, 21988129, 24816443, 27984179, 8190020, 8926495, 9020849		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	21247881, 36585400	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28835126		★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	BEFREE	12519373		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	22411952		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	12843184, 12880121, 19172534, 24512496, 25825716, 26511871, 28860512, 29949806		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	19172534, 20865044, 23599814, 25552498, 25825716, 26848581, 31256208, 36799021	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	23399562		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	10029594	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	21597087	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30520733		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29925687		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	15186320, 28655741		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	26910733	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	23399562		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	23877856	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	23877856		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	30894518		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	21505178, 27709733	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	27072221, 36149194	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30085300	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	10523385		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17635942, 28295444, 28626075, 28985715, 31378101		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	18617186		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	18617186		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	23744686	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31252266		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	17579198, 19656574, 22385118, 22562653, 23844628, 24994579, 25443437, 26162521, 29386237, 30584994		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	26209787, 35233984	Associate	★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	21486418, 22385118, 24458833, 24593124, 24787905, 31030566		★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	8863165		★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	BEFREE	24458833, 24593124		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	10688029, 11331662, 15086020, 16609370, 17343741, 18637150, 19178528, 21937623, 22570967, 23167717, 23386417, 23571770, 2370295, 23729601, 25867301, 26872663, 27051040, 30238986, 30380353, 31810878, 7673412, 8033918, 8274427, 8683794		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	LHGDN	15472213, 16609370, 17453687		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	16957138, 17343741, 20305676, 21937623, 22391641, 22909003, 23167717, 8097257	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32515122	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias 1, X-Linked	Hypospadias, X-Linked	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias 1, X-Linked	Hypospadias, X-Linked	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias 1, X-Linked	Hypospadias, X-Linked	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias, penoscrotal	Hypospadias	BEFREE	18656523, 24907477, 7909666		★☆☆☆☆ Found in Text Mining only
Hypospadias, perineal	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29896988		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19151763, 36720985	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26264969, 26888452, 35302608, 35536859, 36230969	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	9486960		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	9486960		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	22157983	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	34446704	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	12127558		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	18618013, 19318631		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30131669		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	10767487		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	12801573, 16400085, 20150575, 20198568, 20305676, 24186597, 24691874, 25925349	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	11172827, 11591412, 16400085, 19168451, 19937586, 20198568, 28659371, 36142533, 36945970, 39596257	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	7895532		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	21302279		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18535544	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	10398229, 12629412, 9039995		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	9039995	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28767629		★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	18497965		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	11561770, 21109569, 25230018, 31749246		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	18323476, 30639178, 30773606		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	30352393		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	19877028		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	18454468		★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	15956082, 28957431, 9653174		★☆☆☆☆ Found in Text Mining only
Kennedy disease	Kennedy Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36160033	Associate	★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar, Diffuse	Palmoplantar keratoderma	BEFREE	28655741		★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	11286615	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	24956378, 28336462		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31676723		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	23109869		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	18617186		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	18617186		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15704521, 20063560, 9176406	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29533018	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	29533018		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12135669	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19235587		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	19235587		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12135669, 20670477, 31759122	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11850546, 20670477, 31759122		★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	28443693		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	8695152		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28374517, 31233647		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21781458		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11121465, 11166920, 11698569, 12085360, 12154039, 12371139, 14969851, 1648543, 16673293, 16778186, 17230529, 17369855, 19250212, 19815304, 20484730, 21117024, 2177837, 22073224, 22318717, 22819717, 23285165, 23594797, 23620780, 24583399, 24586606, 24860833, 24944078, 25217983, 26451607, 26939703, 27289045, 27688096, 28424556, 28475115, 28599448, 29144509, 29220539, 29254188, 29312607, 30070724, 30150059, 30448543, 30523261, 30569112, 31069844, 31298420, 31337771, 31455870, 31685543, 31759122, 9705896		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12085360, 17230529		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	18639551		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11045572		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	29261670, 37038004	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	24391916	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	24391916		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1648543, 16778186, 17369855, 2177837, 31337771, 9705896		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	LHGDN	18599551		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	21505847	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	19915156, 28404843		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18811692		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29038367, 29207642, 29421153		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30008631, 37716981	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37564195	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21445561, 23388696		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16769699, 21445561, 34797837	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21445561, 23388696		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21445561, 23388696		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21445561, 23388696		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11005214, 24793016, 25588857, 27391842, 28256068, 29059676, 37634315	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24925052	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29030639		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	15466379		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23958352		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	14519624		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	14519624		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	11356158, 24816443, 8926495		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17365134, 17613104, 31480771		★☆☆☆☆ Found in Text Mining only
Male Pseudohermaphroditism	Male Pseudohermaphroditism	BEFREE	11260228, 12006704, 1292987, 16528518, 20056211, 20198568, 3017106, 3876063, 500829, 6541981, 8339746, 9698822		★☆☆☆☆ Found in Text Mining only
Male Pseudohermaphroditism	Male Pseudohermaphroditism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	15154665, 9778630		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9343324		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	14693242, 19843672		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	28115200		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25471750		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10205268, 10359549, 10509795, 10545416, 10711573, 10717532, 10817350, 10964692, 11005214, 11085509, 11139248, 11208351, 11237771, 11368874, 11437399, 11479228, 11494130, 11523047, 11532875, 11561770, 11673900, 11768600, 11861380, 11862478, 11867264, 11927493, 12124798, 12404104, 12582022, 12866037, 1303262, 14504193, 1472451, 14973115, 15544494, 15545219, 15609126, 15625768, 15743497, 15772083, 15827323, 16099479, 16166329, 16317584, 16365023, 16457685, 16791593, 16987421, 17127330, 17187234, 17241382, 17363371, 17429562, 17431821, 17465263, 17631997, 17670913, 17728127, 17850661, 17855696, 17882547, 17904846, 18381432, 18398673, 18437539, 18497066, 18521741, 18562955, 18686047, 18949710, 19276248, 19533338, 19638585, 19898421, 20103632, 20353269, 20431938, 20605569, 20651357, 20814820, 20831839, 20846920, 20947401, 21107681, 21109569, 21159020, 21166701, 2142871, 21532617, 21552212, 21741601, 22021428, 22033271, 22231421, 22321971, 22348324, 22445895, 22471922, 22494987, 22719059, 22745190, 22747683, 22792352, 22825057, 23023562, 23272232, 23377847, 23392859, 23418309, 23460808, 23530127, 23593223, 23663520, 23846226, 24068959, 24172884, 24324816, 24344720, 24356815, 24505496, 24552459, 24570075, 24581183, 24951107, 25001242, 25072326, 25140630, 25178514, 25310144, 25447311, 25454348, 25510351, 25695063, 25722318, 25781993, 25904752, 25907805, 25979597, 26076967, 26201402, 26219822, 26341737, 26345963, 26385458, 26406407, 26487496, 26541420, 26552477, 26554309, 26694952, 26803986, 26902145, 26938985, 27052658, 27340922, 27434295, 27494865, 27496708, 27514395, 27528625, 27548161, 27721402, 27729416, 27793424, 27796944, 27893717, 27959398, 28060723, 28067809, 28106301, 28134791, 28151718, 28208703, 28216130, 28301631, 28359301, 28364216, 28404691, 28430630, 28443693, 28468774, 28570747, 28643022, 28741260, 28766215, 28785183, 28814476, 28816390, 28903441, 28915724, 28916342, 28957377, 28974548, 29053266, 29059676, 29069648, 29078133, 29085503, 29109513, 29131020, 29137314, 29180246, 29187427, 29187464, 29237712, 29254284, 29340907, 29342868, 29353883, 29373071, 29386247, 29423076, 29453314, 29514843, 29578828, 29587674, 29651273, 29662164, 29699584, 29707142, 29713287, 29843115, 29844843, 29890379, 29912871, 29969155, 29970021, 29991699, 30109519, 30208359, 30210453, 30232143, 30254080, 30254184, 30279965, 30367629, 30406874, 30416486, 30445651, 30468800, 30520109, 30539373, 30547831, 30557851, 30577860, 30591548, 30594038, 30606771, 30628666, 30745839, 30795773, 30821186, 30869771, 30941159, 30941650, 31002873, 31004257, 31040043, 31077689, 31110518, 31125586, 31126320, 31207361, 31289138, 31297554, 31367790, 31434793, 31664946, 31693255, 31728025, 31749246, 31822498, 31838731, 7489816, 7649107, 7748811, 7749138, 7792809, 7920176, 8018407, 8101763, 8281139, 8541881, 8695152, 8784104, 8880869, 8959346, 9075695, 9259393, 9537231, 9886853		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	11237771, 21633166, 22174584		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11074602, 12115497, 12767946, 12873984, 15721279, 16161040, 16187285, 19190146, 20053928, 25231075, 26397136, 28071680, 28540420, 28782227, 31256208		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11297235, 12925954, 25724186, 27801498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24520077		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	15358199		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26939703, 30737779, 31298420		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12558872, 18692155, 20035825, 27783866, 28476786, 29112457, 29915882, 30096292, 31426812		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21781458		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10050867, 10706107, 10925355, 11221880, 11368874, 11956643, 12370739, 12404104, 15545219, 17372242, 19623182, 19818997, 22001143, 23443946, 26768617, 27741511, 27835572, 28250337, 28459431, 29716628, 30386380, 30791431, 31495455, 7585507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	15313392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11469683, 20726858, 29301749, 30298303, 9247297		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	30099587		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10029066, 10067845, 10075738, 10079022, 10080920, 10086382, 10218991, 10221569, 10228952, 10234512, 10334909, 10343609, 10344215, 10363963, 10373563, 10385425, 10426191, 10434955, 10482183, 10500149, 10519419, 10537180, 10551783, 10569618, 10574254, 10589774, 10705205, 10706090, 10706109, 10711573, 10734072, 10786674, 10794490, 10797498, 10840043, 10893645, 10910077, 10915221, 10917202, 10953159, 10987273, 10999852, 11016637, 11032808, 11061898, 11097870, 11103816, 11121463, 11140692, 11145738, 11155740, 11179903, 11230990, 11238180, 11245419, 11250774, 11280747, 11299720, 11325816, 11327116, 11350894, 11384871, 11389051, 11401905, 11420135, 11489729, 11494335, 11501969, 11532861, 11535706, 11552710, 11555613, 11582594, 11585771, 11592091, 11595700, 11606392, 11673464, 11676474, 11678763, 11684838, 11702204, 11717329, 11719283, 11720249, 11742035, 11747336, 11803263, 11830526, 11847524, 11857028, 11861374, 11861380, 11888926, 11895908, 11906285, 11914183, 11927493, 11935317, 11948476, 11967956, 11994226, 12015321, 12083956, 12084187, 12089231, 12095985, 12115546, 12140757, 12189490, 12202660, 12210487, 12218053, 12230620, 12237244, 12359344, 12368219, 12376473, 12376504, 12394768, 12429819, 12445232, 12449343, 12456791, 12482965, 12507906, 12514133, 12517791, 12534363, 12539229, 12602915, 12606125, 12629350, 12632109, 12648986, 12659682, 12664061, 12668132, 12672951, 12682292, 12682377, 12717424, 12763015, 12837460, 12845678, 12858356, 12860943, 12890669, 12907631, 12941814, 12949936, 1353965, 14501770, 14570613, 14571418, 14585317, 14607214, 14612503, 14618630, 14619959, 14633682, 14649544, 14654929, 14665948, 14673949, 14680380, 14689584, 14691288, 14691592, 14711828, 14713753, 14713779, 14734014, 14743468, 14744796, 14755679, 14761877, 14985354, 14988390, 14991866, 14996714, 15042597, 15042621, 15062556, 15078173, 15082523, 15124082, 15131260, 15156193, 15161534, 15166229, 15170660, 15174974, 15196705, 15205473, 15256534, 15264247, 15264248, 15289359, 15311058, 15330195, 15350307, 15361837, 15368351, 15375509, 15378487, 15378650, 15389799, 15389811, 15474988, 15479493, 15481440, 15520198, 15533905, 15570555, 15599941, 15604246, 15604291, 15613454, 15617028, 15663988, 15663989, 15665279, 15753383, 15753999, 15755991, 15781642, 15790678, 15808955, 15809670, 15810021, 15821585, 15824176, 15827323, 15833875, 15860262, 15861399, 15894683, 15897571, 15897894, 15900601, 15919721, 15948728, 15952987, 15958518, 15970543, 15982869, 15994976, 16015592, 16015608, 16020662, 16039774, 16061480, 16079302, 16081517, 16099479, 16120611, 16140968, 16140973, 16141232, 16161052, 16166332, 16202619, 16204032, 16210922, 16254899, 16257107, 16266977, 16267015, 16273367, 16275987, 16276440, 16281084, 1631125, 16328002, 16359435, 16365032, 16373395, 16376012, 16384856, 16397271, 16423882, 16425097, 16428447, 16434973, 16434977, 16437189, 16456618, 16461912, 16494870, 16510604, 16513842, 16540674, 16541420, 16556045, 16598769, 16601069, 16621434, 16636679, 16637073, 16637076, 16639715, 16648561, 16679847, 16691616, 16704988, 16705740, 16705743, 16707422, 16707435, 16732317, 16740710, 16741972, 16762975, 16818513, 16835890, 16847812, 16849544, 16870607, 16877366, 16885382, 16914734, 16921507, 16923962, 16927275, 16949795, 16969583, 16980632, 16987421, 17010601, 17015840, 17034507, 17043241, 17044040, 17073759, 17075604, 17079484, 17082327, 17108102, 17108148, 17145880, 17151093, 17163421, 17178887, 17178899, 17185378, 17217995, 17218635, 17219378, 17221841, 17221842, 17242169, 17257635, 17259348, 17262801, 17270024, 17283128, 17297473, 17297502, 17312014, 17321194, 17325038, 17342749, 17346688, 17373716, 17376218, 17387273, 17387277, 17409453, 17415712, 17426252, 17430995, 17440439, 17440969, 17477366, 17483314, 17483368, 17494760, 17503439, 17505060, 17510436, 17540719, 17553165, 17563746, 17578680, 17585029, 17591767, 17595765, 17615153, 17624924, 17634427, 17636035, 17656031, 17679089, 17704139, 17717436, 17728259, 17785571, 17875736, 17906287, 17909037, 17914092, 17935158, 17936615, 17942941, 17942943, 17945479, 17974989, 17975004, 17975021, 17986282, 17986787, 17991730, 18007998, 18023415, 18037956, 18037965, 18045952, 18070607, 18075739, 18079321, 18084330, 18084622, 18158066, 18163427, 18174752, 18181049, 18196538, 18202547, 18217192, 18218096, 18245536, 18270433, 18273831, 18281488, 18302198, 18303483, 18316193, 18320593, 18372911, 18383880, 18413735, 18414397, 18427432, 18450964, 18451177, 18452169, 18469090, 18471792, 18472959, 18479901, 18481277, 18482004, 18483761, 18495332, 18497063, 18497078, 18559499, 18559568, 18593950, 18612129, 18618013, 18627304, 18642328, 18668523, 18694745, 18701487, 18719366, 18723670, 18726991, 18760546, 18762779, 18780293, 18787043, 18794135, 18800375, 18827812, 18829551, 18852121, 18952763, 18958349, 18988800, 18997859, 19010817, 19011039, 19013180, 19018772, 19074897, 19079343, 19080333, 19095061, 19095249, 19111798, 19117982, 19117996, 19117998, 19126541, 19147544, 19155198, 19164447, 19176386, 19189305, 19201527, 19223455, 19223505, 19240183, 19244107, 19257827, 19258514, 19266268, 19277043, 19289629, 19301304, 19318561, 19318562, 19318566, 19318631, 19345326, 19351840, 19351848, 19353593, 19366804, 19372581, 19402094, 19417145, 19463689, 19491261, 19514049, 19520769, 19533338, 19558559, 19575420, 19577536, 19584279, 19608712, 19622577, 19628766, 19635783, 19638459, 19642108, 19642730, 19653278, 19668381, 19670238, 19680443, 19684615, 19737972, 19738047, 19752089, 19787211, 19789348, 19790232, 19790234, 19790238, 19794963, 19808968, 19825963, 19826044, 19884383, 19886863, 19887552, 19901020, 19901962, 19931639, 19947927, 20007693, 20014889, 20023417, 20023700, 20061791, 20066006, 20068182, 20071336, 20102617, 20110352, 20127734, 20127736, 20138542, 20159994, 20160483, 20160498, 20173765, 20181722, 20184087, 20200161, 20203370, 20204290, 20219091, 20308360, 20338164, 20383201, 20417685, 20428214, 20466759, 20478527, 20491624, 20503398, 20534728, 20534771, 20564320, 20564426, 20568894, 20581083, 20587519, 20599793, 20628607, 20632874, 20634343, 20644256, 20660502, 20687225, 20688158, 20711217, 20717902, 20728506, 20729295, 20807808, 20823238, 20826091, 20844012, 20878136, 20878946, 20932825, 20945501, 20955177, 20959290, 20962047, 21036700, 21089003, 21117024, 21125667, 21147815, 21169411, 21170267, 21172304, 21172305, 21177307, 21178266, 21212260, 21216933, 21241418, 21243325, 21244239, 21248069, 21281786, 21284948, 21303972, 21310825, 21317204, 21318127, 21324924, 21330406, 21343391, 21350948, 21387309, 21410629, 21426013, 21432867, 21436259, 21454491, 21486935, 21500190, 21504942, 21506119, 21518863, 21525791, 21532617, 21539745, 21552559, 21555367, 21557276, 21575859, 21596021, 21602269, 21602788, 21606347, 21613449, 21630295, 21632885, 21652578, 21652770, 21656834, 21664423, 21667031, 21667251, 21671247, 21689727, 21705451, 21709130, 21710544, 21712449, 21720703, 21730289, 21748440, 21748469, 21750650, 21765461, 21768780, 21778211, 21784672, 21795710, 21796517, 21796654, 21799006, 21799031, 21820046, 21828060, 21829708, 21846139, 21856747, 21870073, 21885566, 21889355, 21889726, 21901193, 21909140, 21949845, 21950206, 21960693, 21965742, 21968274, 21969603, 21971318, 22007000, 22014572, 22020793, 22027692, 22055461, 22064655, 22083957, 22094279, 22095517, 22095615, 22102282, 22114732, 22120715, 22128178, 22131877, 22154085, 22243777, 22245783, 22258452, 22264502, 22266865, 22272301, 22275114, 22281759, 22282656, 22289337, 22290244, 22298898, 22310774, 22315407, 22344698, 22347450, 22360658, 22362413, 22362414, 22383394, 22396319, 22402316, 22403175, 22411952, 22426480, 22430461, 22431170, 22447200, 22453214, 22456196, 22473304, 22473899, 22495974, 22496481, 22496618, 22505583, 22508765, 22509301, 22532567, 22539113, 22540830, 22542949, 22555282, 22583332, 22583574, 22584579, 22589544, 22592999, 22597536, 22608750, 22610119, 22653589, 22653923, 22654108, 22665440, 22694073, 22695118, 22722839, 22745193, 22761715, 22767266, 22808286, 22821817, 22829593, 22831834, 22879989, 22899854, 22907191, 22986532, 22993403, 23023312, 23023561, 23038474, 23041906, 23056316, 23069658, 23093251, 23104178, 23108626, 23109869, 23130941, 23145034, 23153584, 23159636, 23171135, 23172223, 23184046, 23196061, 23209612, 23212659, 23219429, 23226098, 23246967, 23260764, 23269278, 23307762, 23318417, 23319492, 23326489, 23330817, 23341456, 23349316, 23349811, 23369005, 23386686, 23397433, 23399562, 23403032, 23410126, 23410127, 23410128, 23410129, 23418075, 23426182, 23426362, 23435229, 23437213, 23443807, 23449888, 23451058, 23493267, 23493350, 23493387, 23536649, 23539448, 23559371, 23565753, 23565754, 23565755, 23566222, 23568956, 23571738, 23600948, 23609189, 23615946, 23643785, 23658830, 23661605, 23667504, 23674566, 23699654, 23701543, 23704919, 23710822, 23713567, 23722902, 23724116, 23752196, 23775496, 23779130, 23790802, 23792449, 23798432, 23801747, 23811619, 23813737, 23814488, 23817021, 23840433, 23842682, 23851444, 23851510, 23853093, 23859952, 23863692, 23868789, 23877345, 23893242, 23906537, 23922223, 23925662, 23939374, 23941877, 23951060, 23982466, 23982944, 23995860, 23996639, 24012641, 24019458, 24027196, 24037531, 24038102, 24053777, 24058525, 24084319, 24086346, 24098661, 24100013, 24101480, 24103312, 24121496, 24123015, 24126741, 24129850, 24130778, 24152433, 24163104, 24163230, 24167630, 24173286, 24174655, 24177177, 24186207, 24195515, 24203954, 24222130, 24243687, 24244276, 24258347, 24280133, 24286079, 24292680, 24297183, 24323034, 24347472, 24375805, 24379448, 24391862, 24403252, 24423874, 24441043, 24449822, 24466341, 24480624, 24481405, 24507681, 24508459, 24518515, 24556717, 24561445, 24565564, 24573652, 24574517, 24583551, 24615402, 24634161, 24647988, 24648349, 24659630, 24665929, 24681825, 24694733, 24702180, 24737870, 24740322, 24753418, 24777847, 24779793, 24798453, 24810056, 24812058, 24820830, 24830689, 24845031, 24847116, 24859991, 24861263, 24874833, 24913494, 24925673, 24928520, 24937452, 24942741, 24948870, 24948871, 24948877, 24972028, 24979663, 24981513, 25008967, 25047002, 25048254, 25060817, 25065599, 25080090, 25103771, 25107669, 25109335, 25121586, 25132238, 25135278, 25160502, 25175748, 25184630, 25199985, 25216524, 25216853, 25228652, 25241147, 25269460, 25274033, 25277659, 25296973, 25307492, 25327559, 25327819, 25344584, 25344864, 25358634, 25359680, 25409505, 25415230, 25421658, 25421674, 25432062, 25459660, 25512615, 25537508, 25547524, 25552366, 25552417, 25563847, 25605014, 25605250, 25631036, 25631336, 25634993, 25658610, 25669987, 25670076, 25682698, 25693195, 25700553, 25722318, 25728837, 25756511, 25759396, 25781993, 25793207, 25796442, 25797256, 25846647, 25860954, 25869206, 25883222, 25896606, 25907805, 25908644, 25920548, 25933245, 25934687, 25934801, 25950519, 25965833, 25969144, 25977336, 26008968, 26009876, 26011342, 26017567, 26035357, 26036626, 26052153, 26052614, 26052734, 26056150, 26081756, 26083457, 26093899, 26106075, 26124144, 26152357, 26154658, 26160177, 26175158, 26187015, 26196517, 26201947, 26206497, 26210155, 26235179, 26235627, 26250344, 26257066, 26267320, 26285606, 26294211, 26299608, 26305181, 26310125, 26311513, 26325261, 26332122, 26336104, 26346258, 26364608, 26383955, 26404510, 26411452, 26429394, 26443432, 26448047, 26462181, 26494858, 26501150, 26506594, 26509262, 26512780, 26512963, 26517642, 26527749, 26537258, 26553749, 26554309, 26563462, 26572708, 26573794, 26573802, 26649804, 26657335, 26694952, 26709083, 26714839, 26743006, 26751772, 26803986, 26804168, 26806347, 26808578, 26813233, 26827675, 26828986, 26829214, 26832220, 26847655, 26848868, 26854828, 26855148, 26907477, 26936914, 26940039, 26945682, 26960690, 26986969, 26988939, 26993046, 27019217, 27019329, 27072221, 27098584, 27109471, 27117390, 27120785, 27125450, 27133384, 27174722, 27184811, 27185910, 27193223, 27197266, 27216188, 27223260, 27225190, 27226492, 27238081, 27246333, 27246340, 27255895, 27255944, 27264242, 27267997, 27268279, 27270436, 27276681, 27278879, 27292025, 27300431, 27341831, 27342777, 27357524, 27365400, 27374083, 27375016, 27378372, 27451135, 27473015, 27484210, 27484796, 27486973, 27492635, 27499010, 27526323, 27534968, 27546619, 27554677, 27557496, 27577074, 27582311, 27587619, 27598125, 27634452, 27641228, 27669432, 27672034, 27681649, 27683042, 27689328, 27693493, 27699828, 27702752, 27705939, 27718274, 27721405, 27725309, 27729622, 27741508, 27753448, 27756608, 27760327, 27760825, 27765852, 27775154, 27793987, 27799360, 27800642, 27801901, 27819678, 27825118, 27826989, 27835608, 27838142, 27853318, 27874061, 27897170, 27902483, 27903893, 27909718, 27916435, 27976415, 27977328, 27994514, 28011482, 28025139, 28032932, 28035996, 28036278, 28038451, 28050800, 28052297, 28059768, 28062857, 28069826, 28077788, 28089830, 28091563, 28106301, 28117763, 28126272, 28144231, 28151478, 28151719, 28163245, 28165461, 28166157, 28169398, 28176139, 28181678, 28185938, 28189566, 28209757, 28212551, 28220803, 28224650, 28228262, 28235766, 28240376, 28252832, 28257035, 28264478, 28264911, 28270124, 28272894, 28275218, 28279145, 28287091, 28293633, 28301631, 28302679, 28306720, 28314838, 28324044, 28346812, 28350865, 28359301, 28368512, 28380417, 28381803, 28382154, 28382513, 28386843, 28394264, 28396297, 28397338, 28403781, 28412251, 28415728, 28420128, 28422308, 28428441, 28428880, 28443495, 28444169, 28446230, 28450158, 28463227, 28470764, 28473532, 28473535, 28475016, 28479083, 28483704, 28489571, 28493878, 28498319, 28500234, 28504694, 28507054, 28511652, 28528814, 28536143, 28552345, 28556958, 28566530, 28582660, 28591577, 28594553, 28596572, 28597850, 28600675, 28607007, 28611094, 28611215, 28640128, 28641211, 28655783, 28663546, 28668854, 28675175, 28684411, 28692046, 28692047, 28708672, 28717648, 28724614, 28729398, 28757136, 28775145, 28783103, 28808043, 28811384, 28819026, 28819028, 28824023, 28826481, 28826504, 28827140, 28832499, 28851578, 28851861, 28861162, 28881808, 28882555, 28891793, 28895566, 28901514, 28912144, 28916652, 28917268, 28924059, 28925401, 28928128, 28928821, 28953875, 28968984, 28977599, 28978635, 28981251, 28991234, 29017052, 29030409, 29042395, 29050220, 29051161, 29052905, 29066975, 29069764, 29076496, 29094395, 29104483, 29105980, 29110617, 29136406, 29138500, 29138507, 29142311, 29154974, 29156689, 29170510, 29179452, 29180246, 29181019, 29198908, 29212226, 29225078, 29225160, 29228299, 29249638, 29257308, 29258679, 29285272, 29288523, 29309643, 29317749, 29333925, 29334357, 29342868, 29345000, 29346310, 29353883, 29358171, 29360794, 29366632, 29367197, 29372107, 29381490, 29396873, 29398263, 29402932, 29404276, 29420164, 29425687, 29427323, 29431615, 29435417, 29436611, 29441606, 29444261, 29449534, 29454638, 29456113, 29460922, 29464071, 29473182, 29477539, 29484655, 29494958, 29523594, 29524555, 29527701, 29530945, 29530947, 29555663, 29555975, 29562689, 29568400, 29569310, 29571584, 29574703, 29581250, 29588330, 29606109, 29609138, 29616555, 29618577, 29621897, 29626324, 29633296, 29658587, 29662164, 29662238, 29670000, 29682426, 29686105, 29691406, 29707137, 29707793, 29712835, 29721186, 29730201, 29733509, 29748904, 29749458, 29755968, 29756415, 29758263, 29773186, 29784665, 29786790, 29786798, 29808028, 29808619, 29848701, 29849951, 29853654, 29891491, 29900882, 29905005, 29909987, 29916747, 29934310, 29937939, 29942138, 29956684, 29966326, 29967592, 29969155, 29969286, 29981500, 29983878, 29988112, 29988966, 29993249, 30009471, 30012673, 30027434, 30027545, 30028845, 30030299, 30039761, 30042415, 30051622, 30054487, 30058677, 30069922, 30076933, 30085300, 30101644, 30106164, 30108134, 30109944, 30115758, 30118330, 30125354, 30128923, 30135193, 30141201, 30142696, 30155899, 30165195, 30177389, 30177856, 30183076, 30185422, 30190514, 30197098, 30200999, 30206162, 30206982, 30209899, 30209993, 30210333, 30213689, 30217568, 30223929, 30224543, 30224544, 30228001, 30228209, 30230528, 30236540, 30237440, 30257470, 30270106, 30280407, 30284554, 30294801, 30297600, 30301150, 30305646, 30312731, 30324345, 30334061, 30334814, 30337589, 30365107, 30367117, 30367578, 30374743, 30382885, 30400054, 30401533, 30446660, 30462924, 30464211, 30478421, 30483800, 30489036, 30517868, 30518628, 30525603, 30528321, 30565014, 30565725, 30577860, 30580425, 30603780, 30606742, 30606771, 30613352, 30615932, 30626088, 30626627, 30628724, 30629437, 30639122, 30639309, 30642743, 30644358, 30649323, 30655870, 30664187, 30664691, 30692044, 30693539, 30711833, 30720063, 30733525, 30741558, 30742064, 30761182, 30763142, 30763921, 30770950, 30774773, 30776192, 30805886, 30807779, 30807787, 30808729, 30817318, 30820039, 30828077, 30828298, 30828788, 30833300, 30838415, 30848157, 30855185, 30864701, 30865928, 30871130, 30893145, 30905075, 30913537, 30919167, 30924452, 30925701, 30928381, 30930119, 30933998, 30941159, 30958616, 30963631, 30996246, 31002873, 31006810, 31018586, 31018918, 31027362, 31041742, 31043708, 31051242, 31054895, 31057123, 31062387, 31068457, 31081050, 31083254, 31085587, 31092069, 31110158, 31110275, 31125586, 31135075, 31142021, 31144490, 31144498, 31152093, 31156720, 31158753, 31178279, 31181481, 31181727, 31182548, 31185279, 31192191, 31194651, 31201297, 31212954, 31217781, 31221168, 31222811, 31228231, 31233227, 31258752, 31266892, 31271960, 31273254, 31279298, 31289619, 31308078, 31308362, 31310591, 31334865, 31344408, 31356847, 31357527, 31363002, 31366581, 31370197, 31376206, 31378084, 31400555, 31405024, 31422115, 31423279, 31428587, 31429764, 31434793, 31437779, 31444154, 31462713, 31465841, 31470217, 31477836, 31481513, 31484364, 31484823, 31493989, 31501416, 31501863, 31503366, 31515456, 31519776, 31534371, 31552182, 31578588, 31582422, 31599460, 31604846, 31605368, 31616657, 31620371, 31635359, 31676563, 31686520, 31689899, 31693255, 31695432, 31698174, 31708657, 31712304, 31718606, 31719098, 31730277, 31747605, 31753699, 31755396, 31756402, 31762940, 31769890, 31771198, 31778359, 31783154, 31792211, 31794091, 31796514, 31799745, 31801883, 31804827, 31804970, 31806771, 31809622, 31810118, 31814621, 31816863, 31818479, 31833612, 31838085, 31843555, 31845837, 31846689, 7511045, 7512791, 7626493, 7723794, 7728763, 7795646, 7971517, 8049525, 8187068, 8274409, 8292051, 8426836, 8443809, 8530589, 8717468, 8827083, 8883219, 8912473, 8998186, 9000575, 9032526, 9067292, 9076468, 9076469, 9092797, 9096391, 9111707, 9159212, 9179186, 9211894, 9225161, 9302181, 9422516, 9438000, 9444740, 9537601, 9566751, 9607556, 9607727, 9610786, 9675141, 9699659, 9719026, 9736693, 9744520, 9773979, 9788616, 9815849, 9816170, 9850055, 9886600, 9933058		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	11742035, 12237244, 15389811, 15790600, 16266977, 16877366, 16934689, 16998812, 17003774, 17141945, 18829485, 19011039, 20729295, 22610119, 22666205, 23704919, 25062956, 25735316, 25908785, 25970160, 29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	28208703, 29863801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	23430747, 25563841, 30395538		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11297235, 21482691, 23199240, 23414681, 25203737, 25301736, 26884344, 27713123, 28256068, 30737779, 31413736, 31466817, 31566139		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15723263, 15940630, 16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	16172197, 22882535, 25180665		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22386953		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17406000, 18845648, 22218302, 22608749, 22922989, 23330817, 23447569, 24126741, 24329492, 24662746, 26229034, 26264279, 26342199, 26862755, 27196763, 27330033, 27909718, 28064545, 28241422, 28342317, 28362839, 28869948, 29119053, 29592878, 29659560, 29720561, 29731413, 29964053, 30864720, 30961575, 31006613, 31110275, 31119584, 31234917, 31506605, 31574376, 31803932, 31843555		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10050867, 10569618, 10629558, 10794490, 10910077, 11005214, 11074602, 11103816, 11297235, 11368874, 11572759, 11582594, 11720249, 11862478, 12101115, 12594178, 12717424, 12907631, 14571418, 14652007, 14673949, 14711828, 15124082, 15154665, 15598771, 15809669, 16166332, 16267015, 16275987, 16317584, 16455820, 16601069, 16631458, 16704988, 16731743, 17035230, 17437848, 17850661, 17936615, 18023415, 18075739, 18218096, 18482004, 18539965, 18541154, 18560135, 18668523, 18782595, 18800346, 18829551, 19257827, 19318566, 19351848, 19372581, 19632176, 19668381, 19670238, 20200439, 20534771, 20880698, 21298020, 21487159, 21552212, 21667031, 21671247, 21689727, 21812955, 21864277, 22039516, 22402316, 22583574, 22819717, 22911881, 22922989, 23023312, 23029355, 23145034, 23260764, 23362007, 23414681, 23449888, 23524101, 23549873, 23715826, 23724116, 23734213, 23839233, 23873027, 23939374, 24177177, 24215441, 24481405, 24561445, 24570075, 24573652, 24634161, 24665929, 24913494, 24949437, 25214070, 25241147, 25277175, 25306226, 25359680, 25460502, 25510351, 25563841, 25796113, 25915843, 25965833, 25965834, 25973541, 25979597, 26008968, 26219822, 26364928, 26461474, 26477458, 26503469, 26690121, 26700506, 26939703, 27140928, 27330057, 27341831, 27439682, 27494865, 27499010, 27528625, 27557496, 27634452, 27666367, 27683182, 27713123, 27718274, 27733296, 27909718, 28035996, 28036278, 28064545, 28071680, 28103576, 28112153, 28151718, 28151719, 28208703, 28264911, 28272894, 28382154, 28415728, 28483704, 28512248, 28527407, 28600504, 28600817, 28643022, 28652170, 28824023, 28928128, 28953875, 29023247, 29052817, 29108248, 29131020, 29137314, 29138507, 29181633, 29187427, 29342868, 29346310, 29358171, 29367197, 29372107, 29473182, 29555663, 29569310, 29572225, 29592878, 29707793, 29720561, 29843115, 29863801, 30012673, 30135193, 30135575, 30188709, 30217192, 30230033, 30230528, 30395538, 30448543, 30521479, 30565014, 30606771, 30745839, 30869771, 30925701, 31031857, 31064850, 31185279, 31215730, 31299104, 31323001, 31366519, 31466817, 31493351, 31552182, 31599460, 31616657, 31698174, 31736422, 31759122, 31769890, 31783154, 7971517, 8568474, 8827083, 9179186, 9731888, 9815703		★☆☆☆☆ Found in Text Mining only
Malignant Phyllodes Tumor of Prostate	Malignant prostate phyllodes tumor	BEFREE	17192792		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	12385020, 15105386, 15341991, 16172197, 19656574, 20880698, 22882535, 25180665, 27873769		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30137189, 30957588		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10362109, 11120331, 11297235, 16365013, 16425262, 1715580, 29682205, 7558427		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	11237771, 21633166, 22174584		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	11237771, 21633166, 22174584		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11532875, 11862478, 12779088, 19276248, 21741601, 22471922, 22817771, 23593223, 24324816, 25447311, 25510351, 25979597, 26541420, 26554309, 28151718, 28443693, 28915724, 29254284, 29353883, 29912871, 30367629, 30425121, 31077689, 31126320		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12124798, 12582022, 14504193, 15609126, 16647340, 16791593, 17035230, 17187234, 17413000, 17728127, 17904846, 17942395, 17962208, 18187183, 18562955		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	11237771, 21633166, 22174584		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28115200		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	9378823		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	9378823	Associate	★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	12858007		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25409505		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11168766, 27210747, 27869170, 30395538, 30718742, 31116991		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27210747, 31116991, 31940495, 37838724	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31759122	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10421067, 31649887, 7861224		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	11543741, 15817010, 17178554, 17945479, 19656574, 20808127, 21883946, 23602133, 27108772, 28096796, 28447621, 31480771, 7971517		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19656574, 20808127, 21883946, 23602133, 24269497		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	15091318, 28855438		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	10398229, 12629412, 9039995		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	12068376		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	35262190	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292, 25471750, 35262190	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	21109497		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30113450	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18645714	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18472261, 18645714, 19207614, 29299905, 30153063		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	11005214, 11299720, 11350894, 11803263, 12456791, 15368471, 15604246, 15774258, 15824176, 17079484, 17299418, 17540719, 19257827, 19276271, 21799031, 22767266, 24379448, 24948871, 25327559, 26364608, 26378018, 27054343, 27733296, 28103576, 28219796, 28220803, 28394264, 28427194, 28736322, 28826481, 28925066, 29017058, 29155210, 29276148, 29314004, 29530945, 29644451, 30134822, 30135575, 30141201, 30242112, 30396917, 30425524, 30763756, 30831197, 31117038, 31334879, 31381135, 31604846, 8187068, 8907206, 9850055		★☆☆☆☆ Found in Text Mining only
Micropenis	Micropenis	BEFREE	20305676, 20583543, 21535007, 27051040		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31351215		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19337692	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35867854	Associate	★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Mobius Syndrome	Mobius Syndrome	BEFREE	18645714		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16446741, 28447621		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	16446741		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	28447621	Associate	★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	15003169, 16751763, 16772330, 22720173, 9211187, 9384612		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	10643885, 11499674, 12657679, 1461383, 14999487, 15659427, 17494697, 17997416, 18824496, 21317158, 23364790, 23637164, 24041967, 24742458, 24894177, 28511915, 31351215, 7489816		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease, Lower	Motor Neuron Disease	BEFREE	19965845, 23679084		★☆☆☆☆ Found in Text Mining only
Mouth Abnormalities	Mouth Abnormalities	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12620481	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21781458	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	19185385, 23975434, 27393417, 31495607		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	Pubtator	21829674	Associate	★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	9048921		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	12858007, 9048921		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15735670, 16685431, 30621731		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15735670		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15735670, 20465808	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16023861, 28246026, 29503661		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31779094, 36893254, 39744938	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	16528518, 28453658, 9611069		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	17607372		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	17607372	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12841386		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	9217198		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	9929111	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15890890, 18323476, 29349588		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29483579, 31794514		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	20840067, 22158719, 29478604		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	28256400		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	12707036	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30888496		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	19898421	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	21448923	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10070897, 10209484, 10225449, 10385425, 10428170, 10428464, 10449972, 10547578, 10597254, 10646853, 10815917, 10821498, 10879746, 10910077, 10964692, 10999852, 11005214, 11061898, 11063806, 11127817, 11144509, 11179903, 11280747, 11306464, 11325816, 11350894, 11368874, 11437944, 11481386, 11561770, 11562768, 11572759, 11585771, 11678763, 11712819, 11742035, 11768600, 11857028, 11862478, 11870798, 11994226, 12014620, 12015321, 12036918, 12161010, 12163131, 12371139, 12429819, 12438256, 12445232, 12629350, 12775765, 12779088, 12888829, 12894532, 12907631, 12935925, 12941814, 1353965, 14532783, 14555518, 14619959, 14691288, 14695151, 14695335, 14755679, 15205473, 15311058, 15361837, 15368471, 1552612, 15604246, 15663988, 15665279, 15735670, 15900599, 15947099, 1596904, 16079795, 16166329, 16166332, 16187285, 16187311, 16202619, 16207795, 16210922, 16273367, 16275987, 1631125, 16364759, 16530936, 16685431, 16715229, 16835890, 16849544, 16870607, 16877366, 16885382, 16921507, 17074594, 17079486, 17192792, 17217995, 17262801, 17494760, 17553165, 17626246, 17852420, 17906287, 17925854, 17962208, 17982665, 18007998, 18066052, 18157729, 18158066, 18425676, 18427432, 18471793, 18487222, 18539965, 18559523, 18618087, 18723670, 18787043, 18794357, 18819937, 18922931, 18946223, 19010817, 19011039, 19074897, 19079343, 19080333, 19118031, 19189305, 19240183, 19258514, 19276248, 19289629, 19318631, 19414350, 19533338, 19585490, 19622585, 19635783, 19638459, 19642108, 19668381, 19738126, 19898421, 20204290, 20220849, 20383201, 20464780, 20470445, 20484730, 20634343, 20729295, 20807808, 20878946, 21161326, 21212260, 21224358, 21281786, 21318127, 21330406, 21343391, 21383160, 21387309, 21528410, 21532617, 21613449, 21626233, 21667031, 21761340, 21781227, 21807635, 21856747, 21889725, 21901193, 21982950, 22027692, 22094279, 22095615, 22158653, 22159221, 22179832, 22231421, 22266918, 22272301, 22281759, 22289337, 22409860, 22438320, 22451249, 22531679, 22539113, 22583574, 22594963, 22663543, 22695118, 22722839, 22831834, 22851332, 2285596, 22879924, 22899854, 22907191, 22993403, 23019221, 23069658, 23093251, 23108626, 23155044, 23171135, 23257359, 23272232, 23333074, 23354516, 23373898, 23374602, 23392859, 23418309, 23433514, 23492366, 23493310, 23593223, 23594797, 23715826, 23752196, 23786771, 23860689, 23873027, 23919967, 23928991, 24012641, 24037531, 24058525, 24072181, 24098661, 24163230, 24174655, 24197134, 24222130, 24253417, 24260416, 24329492, 24349321, 24356815, 24387052, 24449822, 24456861, 24481405, 24505496, 24615402, 24634161, 24709423, 24737870, 24779793, 24798453, 24913494, 24916694, 24925673, 24979663, 24986896, 25008967, 25030374, 25043157, 25228652, 25274033, 25306226, 25332247, 25344584, 25356728, 25368192, 25375370, 25382544, 25409505, 25459660, 25510351, 25592291, 25631336, 25634993, 25673182, 25677871, 25693195, 25713333, 25722318, 25796113, 25860954, 25893287, 25904752, 25908644, 25915843, 25934687, 25934801, 25950519, 25969144, 25979597, 26009876, 26081756, 26093899, 26106075, 26152357, 26201402, 26229034, 26260807, 26284333, 26285606, 26385458, 26443432, 26451607, 26452060, 26487496, 26509262, 26537258, 26544944, 26552477, 26554309, 26573802, 26649804, 26804168, 26814892, 26868122, 26921821, 26936914, 26938985, 26993046, 27019329, 27133384, 27216188, 27267807, 27267997, 27272216, 27274052, 27276681, 27305909, 27325180, 27350136, 27393417, 27422777, 27440270, 27462022, 27473672, 27514395, 27528625, 27546619, 27550197, 27634876, 27645128, 27663436, 27672740, 27683182, 27702818, 27729416, 27730305, 27748439, 27760327, 27764839, 27765852, 27775154, 27801498, 27848972, 27959342, 27996095, 28036278, 28052297, 28077788, 28112153, 28151719, 28194662, 28229217, 28235766, 28241422, 28253524, 28256068, 28287091, 28384066, 28423563, 28430338, 28439009, 28493878, 28498319, 28512248, 28614298, 28643022, 28692046, 28741260, 28872768, 28900498, 28912144, 28924064, 28947209, 28953875, 28957377, 29033586, 29042395, 29059155, 29059676, 29069648, 29094395, 29100362, 29108248, 29111177, 29119053, 29121144, 29126837, 29133261, 29137314, 29148069, 29187427, 29198908, 29243324, 29276148, 29299975, 29309643, 29334357, 29358171, 29367197, 29371946, 29373071, 29385707, 29423076, 29463549, 29464071, 29508425, 29564569, 29569310, 29581250, 29587674, 29626121, 29670000, 29682426, 29716628, 29720561, 29756415, 29757697, 29765513, 29773186, 29784665, 29844167, 29844843, 29849951, 29853654, 29882386, 29890379, 29912871, 29921690, 29955787, 29967592, 30028845, 30049486, 30058677, 30091920, 30099587, 30109519, 30154150, 30165195, 30183076, 30197098, 30208359, 30210453, 30228209, 30250564, 30267779, 30279965, 30284554, 30297600, 30367117, 30367629, 30416486, 30425121, 30520109, 30528321, 30591548, 30594038, 30606771, 30629437, 30677079, 30692600, 30713780, 30718742, 30733286, 30808676, 30808729, 30830274, 30833441, 30912411, 30919276, 30930119, 30961575, 30979864, 30986993, 31002873, 31036442, 31051242, 31077689, 31110158, 31110518, 31113841, 31116991, 31142021, 31151151, 31176622, 31192191, 31205562, 31239703, 31244925, 31266833, 31312026, 31357527, 31358900, 31361600, 31430492, 31448633, 31466817, 31481513, 31484364, 31493351, 31495607, 31519572, 31522216, 31604846, 31613683, 31616657, 31632533, 31636720, 31640441, 31649887, 31664946, 31749246, 31759122, 31766290, 31772120, 31778359, 31792211, 31801883, 31803932, 31822498, 31838731, 7495286, 7641206, 7683573, 7795646, 7861224, 7895532, 7971517, 8101763, 8145761, 8242615, 8292051, 8407551, 8426836, 8561865, 8628719, 8630948, 8780407, 8907206, 8994191, 9000575, 9076469, 9111707, 9120730, 9159212, 9179186, 9612688, 9622067, 9625172, 9653174, 9675141, 9724102, 9735408, 9788616, 9796995, 9816170, 9894460		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10490105, 11299720, 18535113, 18631392, 29414825		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	24956378, 28336462		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	14698481, 17945479, 18560135, 21949845, 30639178		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	15994236	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	28430338		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11335100, 12962912, 12968071, 15809725, 19237573, 20410122, 28326012, 29428674, 9384612		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12968071	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19497852, 36585400	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	11335100, 11356158, 11684838, 12393801, 12943692, 15897156, 16644868, 16751763, 17073759, 17550941, 17596176, 18423405, 19237573, 20621188, 20869592, 22366762, 22660636, 23719921, 28031322		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	17393410		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	17393410		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	17393410		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	27289045		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	10956560, 21745497, 23644820, 24150846, 25047668, 25168383, 26515625, 26872663, 26971100, 28087734, 29427100, 30644418, 31310754, 31395886, 31537808, 31686397		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	7870107		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	19448851		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	10396290		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	25744849, 31252266, 31455870		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15496427, 17349623, 18692155, 18980991, 19185385, 20803614, 27923629, 28600504, 29915882, 30660770, 30911072		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	15496427, 16230376		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28424556, 30523261		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	21109569, 21552212, 24715382, 28968271, 31833179		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17825390, 22025404, 25925349, 29895265		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25925349	Associate	★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	BEFREE	17919607		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	39286977	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	16647340, 17850661, 22555282, 26124144, 26385458, 27528625, 27729416, 28272969, 28430630, 28643022, 29069648, 29078133, 29181633, 29423076, 30795773, 31059536, 31151151		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	10050656, 10470409, 12478141, 14511213, 20198568, 22829593, 3106395, 7926115		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	18199976		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	29405430		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	29082243, 31720992		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	16098017		★☆☆☆☆ Found in Text Mining only
Osteoma	Osteoma	BEFREE	18806481		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19629928, 29967592, 31389012		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	12593895		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	14517714, 14667136, 15536520, 16117826, 24994579, 30569509, 30639122, 31731497		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36815982	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29785666		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26249023, 28262798	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26503469, 28262798, 30093700, 31715352		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31495455		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	10823139, 28472976, 31759122	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Dysgenesis 2	Ovarian dysgenesis	Pubtator	20672904	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	18281036, 19684044, 20672904, 21050150, 30098699, 30156935		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	LHGDN	18281036		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	31167229		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10050867, 10706107, 10925355, 11221880, 11368874, 11956643, 12370739, 12404104, 15545219, 17372242, 19623182, 19818997, 22001143, 25915843, 26768617, 27741511, 27835572, 28250337, 28459431, 29716628, 30386380, 30791431		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	11474658, 15545219, 17372242, 18374401		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	15313392		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10318951	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10811499, 11437399, 15545219, 15994977, 19623182, 22022581, 25261255, 25608477, 26556855, 26768617, 27835572, 28467804, 32366278, 33891016, 34763937, 35134468, 35639349	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	21270324		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	12767274, 16705740, 19668381, 21437722, 23341456, 24812058, 30482547, 31493989		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	29082243, 31720992		★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA, NONEPIDERMOLYTIC	Nonepidermolytic palmoplantar keratoderma	BEFREE	28655741		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11469683, 20726858, 29301749, 30298303, 9247297		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24520077		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11469683, 20726858, 29115476, 34143198	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	9665487	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12858007, 22386953, 22434481, 22562579		★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	BEFREE	28198660, 30496189		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	29254595		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12392775		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	11768600		★☆☆☆☆ Found in Text Mining only
Partial androgen insensitivity syndrome	Partial Androgen Insensitivity Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	37430099	Associate	★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	10688029, 11331662, 15086020, 16609370, 17343741, 18637150, 19178528, 21937623, 22570967, 23167717, 23386417, 23571770, 2370295, 23729601, 25867301, 26872663, 27051040, 30238986, 30380353, 31810878, 7673412, 8033918, 8683794		★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	BEFREE	20305676, 20583543, 21535007, 27051040		★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31389012		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31389012		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28626075		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28626075		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	30804124, 9176406	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	19167832		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	21883946		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	17192792, 9088032		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	29369390		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	24593124		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	22570239		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	10999852, 11788641, 14505758, 15950642, 16793958, 18191848, 18192296, 18303071, 18483883, 18555222, 18697861, 19172534, 20190557, 20450840, 20691435, 21050150, 22068615, 22107839, 22238403, 22344533, 22695532, 22724574, 23628801, 23900753, 24116069, 24986529, 25130462, 25148265, 25552498, 25825716, 26493122, 26511871, 27163385, 28320971, 28860512, 28938480, 29055809, 29618656, 29949806, 30153063, 30267260, 30483787, 30745857, 30912811, 31125975, 31256208		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	18191848, 18192296, 18697861		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	18191848, 18303071, 18555222, 19172534, 20865044, 22724574, 23599814, 25237893, 25393639, 25552498, 25825716, 27725361, 29206944, 31256208, 32283997, 32412125, 32488141, 34053455, 34477128, 36799021, 37936145, 38008503	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36476625	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	15710583		★☆☆☆☆ Found in Text Mining only
Porencephaly	Porencephaly	BEFREE	16061602		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	25925349		★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	16403814, 20691435, 27725361		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	12146732		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	20670477		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	31383950		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	18281036, 19684044, 20672904, 21050150, 30098699		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	30411380		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 2	Hyperoxaluria	Pubtator	35135181	Associate	★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	17852420, 20672904, 30165367		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30411380		★☆☆☆☆ Found in Text Mining only
Progressive Muscular Atrophy	Progressive Muscular Atrophy	BEFREE	12372280		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	10574254, 20173765, 28257035	Associate	★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	11494335, 12539229, 20173765		★☆☆☆☆ Found in Text Mining only
PROSTATE CANCER, SOMATIC	Prostate Cancer	BEFREE	16365032, 17591767		★☆☆☆☆ Found in Text Mining only
PROSTATE CANCER, SOMATIC	Prostate Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10029066, 10067845, 10075738, 10080920, 10086382, 10218991, 10221569, 10228952, 10234512, 10334909, 10343609, 10344215, 10373563, 10385425, 10426191, 10434955, 10482183, 10500149, 10519419, 10537180, 10547578, 10551783, 10569618, 10574254, 10705205, 10706090, 10706109, 10711573, 10734072, 10786674, 10794490, 10797498, 10840043, 10893645, 10910077, 10915221, 10917202, 10953159, 10965888, 10987273, 10999852, 11016637, 11032808, 11061898, 11097870, 11103816, 11121463, 11140692, 11145738, 11155740, 11179903, 11230990, 11238180, 11245419, 11245473, 11250774, 11280747, 11299720, 11304731, 11325816, 11327116, 11350894, 11384871, 11389051, 11401905, 11420135, 11489729, 11494335, 11501969, 11532861, 11535706, 11550169, 11552710, 11555613, 11571725, 11582594, 11585771, 11592091, 11595700, 11606392, 11673464, 11676474, 11678763, 11684838, 11702204, 11717329, 11719283, 11720249, 11742035, 11745195, 11747336, 11803263, 11830526, 11847524, 11857028, 11861374, 11861380, 11888926, 11895908, 11906285, 11914183, 11927493, 11935317, 11948476, 11967956, 11994226, 12083956, 12084187, 12089231, 12095985, 12115546, 12140757, 12189490, 12202660, 12210487, 12218053, 12230620, 12237244, 12359344, 12368219, 12376473, 12376504, 12394768, 12429819, 12445232, 12449343, 12456791, 12482965, 12507906, 12514133, 12534363, 12539229, 12602915, 12606125, 12629350, 12632109, 12648986, 12659682, 12664061, 12668132, 12672951, 12682292, 12682377, 12717424, 12763015, 12837460, 12845678, 12858356, 12860943, 12890669, 12907631, 12941814, 12949936, 12970580, 1353965, 1446639, 14501770, 14570613, 14571418, 14585317, 14607214, 14612503, 14618630, 14619959, 14633682, 14649544, 14654929, 14665948, 14673949, 14680380, 14689584, 14691288, 14691592, 14711828, 14713753, 14713779, 14734014, 14744796, 14755679, 14761877, 14985354, 14988390, 14991866, 14996714, 15042597, 15042621, 15062556, 15078173, 15082523, 15124082, 15131260, 15156193, 15161534, 15166229, 15170660, 15174974, 15196705, 15205473, 15256534, 15264247, 15264248, 15289359, 15311058, 15330195, 15350307, 15361837, 15368351, 15375509, 15378487, 15378650, 15389799, 15389811, 15474988, 15479493, 15481440, 15486991, 15520198, 15533905, 15570555, 15599941, 15604246, 15604291, 15613454, 15617028, 15630701, 15663988, 15663989, 15665279, 15753383, 15753999, 15755991, 15781642, 15790678, 15808955, 15809670, 15810021, 15821585, 15824176, 15827323, 15833875, 15860262, 15861399, 15894683, 15897894, 15900601, 15919721, 15948728, 15952987, 15970543, 15982869, 15994976, 16015592, 16015608, 16020662, 16039774, 16061480, 16079302, 16081517, 16099479, 16120611, 16140968, 16140973, 16161052, 16166332, 16202619, 16204032, 16210922, 16254899, 16257107, 16266977, 16267015, 16273367, 16275987, 16276440, 16281084, 1631125, 16328002, 16359435, 16365032, 16373395, 16376012, 16384856, 16397271, 16423882, 16425097, 16428447, 16434973, 16434977, 16437189, 16456618, 16461912, 16494870, 16510604, 16513842, 16540674, 16541420, 16556045, 16598769, 16601069, 16601286, 16621434, 16636679, 16637073, 16637076, 16639715, 16648561, 16679847, 16691616, 16704988, 16705740, 16705743, 16707422, 16707435, 16732317, 16740710, 16741972, 16762975, 16818513, 16847812, 16849544, 16870607, 16885382, 16914734, 16921507, 16923962, 16927275, 16949795, 16969583, 16987421, 17010601, 17015840, 17034507, 17043241, 17044040, 17073759, 17079484, 17082327, 17108102, 17108148, 17145880, 17151093, 17163421, 17178887, 17178899, 17185378, 17217995, 17218635, 17219378, 17221841, 17221842, 17242169, 17257635, 17259348, 17262801, 17270024, 17283128, 17297473, 17297502, 17312014, 17321194, 17325038, 17342749, 17346688, 17373716, 17376218, 17387273, 17387277, 17409453, 17415712, 17426252, 17430995, 17440439, 17477366, 17483314, 17483368, 17494760, 17503439, 17505060, 17510436, 17540719, 17553165, 17563746, 17578680, 17585029, 17591767, 17595765, 17615153, 17624924, 17634427, 17636035, 17656031, 17679089, 17704139, 17717436, 17728259, 17785571, 17875736, 17906287, 17909037, 17914092, 17935158, 17936615, 17942941, 17942943, 17945479, 17974989, 17975004, 17975021, 17986282, 17986787, 17991730, 18007998, 18023415, 18037956, 18037965, 18045952, 18070607, 18075739, 18079321, 18084330, 18084622, 18158066, 18163427, 18174752, 18181049, 18196538, 18202547, 18217192, 18218096, 18245536, 18270433, 18273831, 18281488, 18302198, 18303483, 18316193, 18320593, 18372911, 18383880, 18413735, 18414397, 18427432, 18450964, 18451177, 18452169, 18454446, 18469090, 18471792, 18472959, 18481277, 18482004, 18483761, 18495332, 18497063, 18497078, 18559499, 18559523, 18559568, 18593950, 18612129, 18618013, 18627304, 18642328, 18668523, 18694745, 18719366, 18723670, 18726991, 18760546, 18762779, 18787043, 18794135, 18800375, 18827812, 18829551, 18852121, 18952763, 18958349, 18997859, 19010817, 19011039, 19013180, 19018772, 19074897, 19079343, 19080333, 19095061, 19095249, 19111798, 19117982, 19117996, 19117998, 19126541, 19147544, 19155198, 19164447, 19176386, 19189305, 19201527, 19223455, 19223505, 19240183, 19244107, 19257827, 19258514, 19266268, 19277043, 19289629, 19301304, 19318561, 19318566, 19318631, 19345326, 19351840, 19351848, 19353593, 19366804, 19372581, 19402094, 19417145, 19463689, 19489685, 19491261, 19514049, 19520769, 19533338, 19558559, 19575420, 19577536, 19584279, 19608712, 19622577, 19628766, 19635783, 19638459, 19642108, 19642730, 19653278, 19661309, 19670238, 19680443, 19684615, 19737972, 19738047, 19752089, 19787211, 19789348, 19790232, 19790234, 19790238, 19794963, 19808968, 19825963, 19826044, 19884383, 19886863, 19901020, 19901962, 19931639, 19947927, 20007693, 20023417, 20023700, 20061791, 20066006, 20068182, 20071336, 20102617, 20110352, 20127734, 20127736, 20138542, 20159994, 20160483, 20160498, 20173765, 20184087, 20200161, 20203370, 20204290, 20219091, 20308360, 20338164, 20383201, 20417685, 20428214, 20466759, 20478527, 20491624, 20503398, 20534728, 20534771, 20564320, 20564426, 20568894, 20581083, 20587519, 20599793, 20628607, 20632874, 20634343, 20644256, 20660502, 20687225, 20688158, 20711217, 20717902, 20728506, 20729295, 20807808, 20823238, 20826091, 20844012, 20878136, 20878946, 20932825, 20945501, 20955177, 20959290, 20962047, 21036700, 21089003, 21117024, 21125667, 21147815, 21169411, 21170267, 21172304, 21172305, 21177307, 21178266, 21212260, 21216933, 21241418, 21243325, 21244239, 21248069, 21284948, 21303972, 21310825, 21317204, 21318127, 21324924, 21330406, 21343391, 21350948, 21387309, 21410629, 21436259, 21454491, 21486935, 21500190, 21504942, 21506119, 21518863, 21525791, 21532617, 21539745, 21552559, 21555367, 21557276, 21575859, 21596021, 21602269, 21602788, 21606347, 21613449, 21630295, 21632885, 21652578, 21652770, 21656834, 21667031, 21667251, 21671247, 21689727, 21705451, 21709130, 21710544, 21712449, 21720703, 21730289, 21748440, 21748469, 21750650, 21765461, 21768780, 21778211, 21784672, 21795710, 21796517, 21796654, 21799006, 21799031, 21820046, 21828060, 21829708, 21846139, 21856747, 21870073, 21885566, 21889355, 21889726, 21901193, 21909140, 21949845, 21950206, 21960693, 21965742, 21968274, 21969603, 21971318, 22007000, 22014572, 22020793, 22027692, 22055461, 22064655, 22083957, 22094279, 22095517, 22095615, 22102282, 22114732, 22120715, 22128178, 22131877, 22154085, 22243777, 22258452, 22264502, 22266865, 22272301, 22275114, 22281759, 22282656, 22289337, 22290244, 22298898, 22310774, 22315407, 22344698, 22347450, 22360658, 22362413, 22362414, 22383394, 22396319, 22402316, 22403175, 22411952, 22426480, 22430461, 22431170, 22447200, 22453214, 22456196, 22473304, 22473899, 22495974, 22496481, 22496618, 22505583, 22508765, 22509301, 22532567, 22539113, 22540830, 22542949, 22555282, 22583332, 22583574, 22584579, 22589544, 22592999, 22597536, 22608750, 22610119, 22653589, 22653923, 22654108, 22665440, 22694073, 22695118, 22722839, 22745193, 22761715, 22767266, 22808286, 22821817, 22829593, 22831834, 22879989, 22899854, 22907191, 22986532, 22993403, 23023312, 23023561, 23038474, 23041906, 23056316, 23069658, 23093251, 23104178, 23108626, 23109869, 23130941, 23145034, 23153584, 23159636, 23171135, 23172223, 23184046, 23196061, 23209612, 23212659, 23219429, 23226098, 23246967, 23260764, 23269278, 23307762, 23318417, 23319492, 23330817, 23341456, 23349316, 23349811, 23369005, 23386686, 23397433, 23399562, 23403032, 23410126, 23410127, 23410128, 23410129, 23418075, 23426182, 23426362, 23435229, 23437213, 23443807, 23449888, 23451058, 23493267, 23493350, 23493387, 23536649, 23539448, 23559371, 23565753, 23565754, 23565755, 23566222, 23568956, 23571738, 23600948, 23609189, 23615946, 23643785, 23658830, 23661605, 23667504, 23674566, 23699654, 23701543, 23704919, 23710822, 23713567, 23722902, 23724116, 23752196, 23775496, 23779130, 23790802, 23792449, 23798432, 23801747, 23811619, 23813737, 23814488, 23817021, 23840433, 23842682, 23851444, 23851510, 23853093, 23859952, 23863692, 23868789, 2386943, 23877345, 23893242, 23906537, 23922223, 23925662, 23939374, 23941877, 23951060, 23982466, 23982944, 23995860, 23996639, 24012641, 24019458, 24027196, 24037531, 24038102, 24053777, 24058525, 24084319, 24086346, 24098661, 24100013, 24101480, 24103312, 24121496, 24123015, 24126741, 24129850, 24130778, 24152433, 24163104, 24163230, 24167630, 24173286, 24174655, 24177177, 24186207, 24195515, 24203954, 24222130, 24243687, 24244276, 24258347, 24280133, 24286079, 24292680, 24297183, 24323034, 24347472, 24375805, 24379448, 24391862, 24403252, 24423874, 24441043, 24449822, 24466341, 24480624, 24481405, 24507681, 24508459, 24518515, 24556717, 24561445, 24565564, 24573652, 24574517, 24583551, 24615402, 24634161, 24647988, 24648349, 24659630, 24665929, 24681825, 24694733, 24702180, 24737870, 24740322, 24753418, 24777847, 24779793, 24798453, 24810056, 24812058, 24820830, 24830689, 24845031, 24847116, 24859991, 24861263, 24874833, 24913494, 24925673, 24928520, 24937452, 24942741, 24948870, 24948871, 24948877, 24972028, 24979663, 24981513, 25008967, 25047002, 25048254, 25060817, 25065599, 25080090, 25103771, 25107669, 25109335, 25121586, 25132238, 25135278, 25158280, 25175748, 25184630, 25199985, 25216524, 25216853, 25228652, 25241147, 25269460, 25274033, 25277659, 25296973, 25307492, 25327559, 25327819, 25344584, 25344864, 25358634, 25359680, 25409505, 25415230, 25421658, 25421674, 25432062, 25459660, 25512615, 25537508, 25547524, 25552366, 25552417, 25563847, 25605250, 25631036, 25631336, 25634993, 25658610, 25669987, 25670076, 25673182, 25682698, 25693195, 25700553, 25722318, 25728837, 25756511, 25759396, 25793207, 25796442, 25797256, 25846647, 25860954, 25869206, 25883222, 25896606, 25907805, 25908644, 25920548, 25933245, 25934687, 25934801, 25950519, 25965833, 25969144, 26008968, 26009876, 26011342, 26017567, 26035357, 26036626, 26052153, 26052614, 26052734, 26056150, 26081756, 26083457, 26093899, 26106075, 26124144, 26152357, 26154658, 26160177, 26175158, 26187015, 26196517, 26201947, 26206497, 26210155, 26235179, 26235627, 26250344, 26257066, 26267320, 26285606, 26294211, 26299608, 26305181, 26310125, 26311513, 26325261, 26332122, 26336104, 26346258, 26364608, 26383955, 26404510, 26411452, 26429394, 26443432, 26448047, 26462181, 26494858, 26501150, 26506594, 26509262, 26512780, 26512963, 26517642, 26527749, 26537258, 26553749, 26554309, 26563462, 26572708, 26573794, 26573802, 26649804, 26657335, 26694952, 26709083, 26714839, 26743006, 26751772, 26803986, 26804168, 26806347, 26808578, 26813233, 26827675, 26828986, 26829214, 26832220, 26847655, 26848868, 26854828, 26855148, 26907477, 26936914, 26940039, 26945682, 26960690, 26986969, 26988939, 26993046, 27019217, 27019329, 27072221, 27098584, 27106747, 27109471, 27117390, 27120785, 27125450, 27133384, 27174722, 27184811, 27185910, 27193223, 27197266, 27216188, 27223260, 27225190, 27226492, 27238081, 27246333, 27246340, 27255895, 27255944, 27264242, 27267997, 27268279, 27270436, 27276681, 27278879, 27292025, 27300431, 27341831, 27342777, 27357524, 27374083, 27375016, 27378372, 27451135, 27473015, 27484210, 27484796, 27486973, 27492635, 27499010, 27526323, 27534968, 27546619, 27554677, 27557496, 27577074, 27582311, 27587619, 27598125, 27634452, 27669432, 27672034, 27681649, 27683042, 27689328, 27693493, 27699828, 27702752, 27705939, 27718274, 27725309, 27729622, 27741508, 27753448, 27756608, 27760327, 27760825, 27765852, 27775154, 27793987, 27799360, 27800642, 27801901, 27819678, 27825118, 27826989, 27835608, 27838142, 27853318, 27874061, 27897170, 27902483, 27903893, 27909718, 27916435, 27976415, 27977328, 27994514, 28011482, 28025139, 28032932, 28035996, 28036278, 28038451, 28050800, 28052297, 28059768, 28062857, 28069826, 28077788, 28089830, 28091563, 28106301, 28117763, 28126272, 28144231, 28151478, 28151719, 28163245, 28165461, 28166157, 28169398, 28176139, 28181678, 28185938, 28189566, 28209757, 28212551, 28220803, 28228262, 28235766, 28240376, 28252832, 28257035, 28264478, 28264911, 28270124, 28272894, 28275218, 28279145, 28287091, 28293633, 28301631, 28302679, 28306720, 28314838, 28324044, 28346812, 28350865, 28359301, 28368512, 28380417, 28381803, 28382154, 28382513, 28386843, 28394264, 28396297, 28397338, 28400549, 28403781, 28412251, 28415728, 28420128, 28422308, 28428441, 28428880, 28443495, 28444169, 28446230, 28450158, 28463227, 28470764, 28473532, 28473535, 28475016, 28479083, 28483704, 28489571, 28493878, 28498319, 28500234, 28504694, 28507054, 28511652, 28528814, 28536143, 28552345, 28556958, 28566530, 28582660, 28591577, 28596572, 28597850, 28600675, 28611094, 28611215, 28640128, 28655783, 28663546, 28668854, 28675175, 28684411, 28692046, 28692047, 28708672, 28717648, 28724614, 28729398, 28757136, 28775145, 28783103, 28808043, 28811384, 28819026, 28819028, 28824023, 28826481, 28826504, 28827140, 28832499, 28851578, 28851861, 28861162, 28881808, 28882555, 28891793, 28895566, 28901514, 28912144, 28916652, 28917268, 28924059, 28925401, 28928128, 28928821, 28953875, 28968984, 28977599, 28978635, 28981251, 28991234, 29017052, 29017058, 29030409, 29042395, 29050220, 29051161, 29052905, 29066975, 29069764, 29076496, 29094395, 29104483, 29105980, 29110617, 29136406, 29138500, 29138507, 29142311, 29154974, 29156689, 29170510, 29179452, 29180246, 29198908, 29212226, 29225078, 29225160, 29228299, 29249638, 29257308, 29258679, 29285272, 29288523, 29309643, 29317749, 29333925, 29334357, 29342868, 29345000, 29346310, 29353883, 29358171, 29360794, 29366632, 29367197, 29372107, 29381490, 29396873, 29398263, 29402932, 29404276, 29420164, 29425687, 29427323, 29431615, 29435417, 29436611, 29441606, 29444261, 29449534, 29454638, 29456113, 29460922, 29464071, 29473182, 29477539, 29484655, 29494958, 29523594, 29524555, 29527701, 29530945, 29530947, 29555663, 29555975, 29562689, 29568400, 29569310, 29571584, 29574703, 29581250, 29588330, 29606109, 29609138, 29616555, 29618577, 29621897, 29626324, 29633296, 29658587, 29662164, 29662238, 29670000, 29682426, 29686105, 29691406, 29707137, 29707793, 29712835, 29721186, 29730201, 29733509, 29748904, 29749458, 29755968, 29756415, 29758263, 29773186, 29784665, 29786790, 29786798, 29808028, 29808619, 29848701, 29849951, 29853654, 29891491, 29900882, 29905005, 29909987, 29916747, 29934310, 29937939, 29942138, 29956684, 29966326, 29967592, 29969155, 29969286, 29981500, 29983878, 29988112, 29988966, 29993249, 30009471, 30012673, 30027434, 30027545, 30028845, 30030299, 30039761, 30042415, 30051622, 30054487, 30058677, 30069922, 30076933, 30085300, 30101644, 30106164, 30108134, 30109944, 30115758, 30118330, 30125354, 30128923, 30135193, 30141201, 30142696, 30155899, 30165195, 30177389, 30177856, 30183076, 30185422, 30190514, 30197098, 30200999, 30206162, 30206982, 30209899, 30209993, 30210333, 30213689, 30217568, 30224543, 30224544, 30228001, 30228209, 30230528, 30236540, 30237440, 30257470, 30270106, 30280407, 30284554, 30294801, 30297600, 30301150, 30305646, 30312731, 30324345, 30334061, 30334814, 30337589, 30365107, 30367117, 30367578, 30374743, 30382885, 30400054, 30401533, 30446660, 30462924, 30464211, 30478421, 30483800, 30489036, 30517868, 30518628, 30528321, 30565014, 30565725, 30577860, 30580425, 30603780, 30606742, 30606771, 30613352, 30615932, 30626088, 30626627, 30628724, 30629437, 30639122, 30639309, 30642743, 30644358, 30649323, 30655870, 30664187, 30664691, 30692044, 30693539, 30711833, 30720063, 30733525, 30741558, 30742064, 30761182, 30763142, 30763921, 30770950, 30774773, 30776192, 30805886, 30807779, 30807787, 30808729, 30817318, 30820039, 30828077, 30828298, 30828788, 30833300, 30838415, 30848157, 30855185, 30864701, 30865928, 30871130, 30893145, 30905075, 30913537, 30919167, 30924452, 30925701, 30928381, 30930119, 30933998, 30941159, 30958616, 30963631, 30996246, 31002873, 31006810, 31018586, 31018918, 31027362, 31041742, 31043708, 31051242, 31054895, 31057123, 31062387, 31068457, 31081050, 31083254, 31085587, 31092069, 31110158, 31110275, 31125586, 31135075, 31142021, 31144490, 31144498, 31152093, 31156720, 31158753, 31178279, 31181481, 31181727, 31182548, 31185279, 31192191, 31194651, 31201297, 31212954, 31217781, 31221168, 31222811, 31228231, 31233227, 31258752, 31266892, 31271960, 31273254, 31279298, 31289619, 31308078, 31308362, 31310591, 31334865, 31344408, 31356847, 31357527, 31363002, 31366581, 31370197, 31376206, 31378084, 31400555, 31405024, 31422115, 31423279, 31428587, 31429764, 31434793, 31437779, 31444154, 31462713, 31465841, 31470217, 31477836, 31481513, 31484364, 31484823, 31493989, 31501416, 31501863, 31503366, 31515456, 31519776, 31534371, 31578588, 31582422, 31599460, 31604846, 31605368, 31616657, 31620371, 31635359, 31676563, 31686520, 31689899, 31693255, 31695432, 31698174, 31708657, 31712304, 31718606, 31730277, 31747605, 31753699, 31755396, 31756402, 31762940, 31769890, 31771198, 31778359, 31783154, 31792211, 31796514, 31799745, 31801883, 31804827, 31804970, 31806771, 31809622, 31810118, 31814621, 31816863, 31818479, 31833612, 31838085, 31843555, 31845837, 31846689, 7511045, 7512791, 7522959, 7626493, 7728763, 7770997, 7795646, 7971517, 8049525, 8145761, 8187068, 8274409, 8292051, 8443809, 8717468, 8827083, 8883219, 8907206, 8912473, 8998186, 9000575, 9032526, 9067292, 9076468, 9076469, 9092797, 9096391, 9111707, 9159212, 9179186, 9211894, 9225161, 9302181, 9422516, 9438000, 9444740, 9488733, 9537601, 9566751, 9607556, 9607727, 9610786, 9675141, 9699659, 9719026, 9736693, 9744520, 9773979, 9788616, 9815849, 9816170, 9850055, 9886600, 9933058		★☆☆☆☆ Found in Text Mining only
Prostatic Cancer, Castration-Resistant	Prostatic Cancer, Castration-Resistant	CTD_human_DG	18985049, 24740322, 28500234, 28757136		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	11684838, 12670590, 16039774, 18320593, 18450964, 18560202, 25409505		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	18217192, 18560202, 18627423, 19645433, 25409505	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	10343609, 14619959, 26677878, 28694768		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	10343609, 15310009, 18217192, 22157983, 23792768, 26709083, 27226548, 30028845, 32412125, 35821619	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	12111704, 15136785, 17979523		★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	10343609, 28694768		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	20601956, 27072221	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	31054895	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	12845678, 14716741, 16401639, 19789348, 21518863, 24130167, 24492704, 27072221, 28493878, 8827081		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	14743468		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	CTD_human_DG	20601956		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10075669, 10318905, 10428808, 10500149, 10569618, 10574254, 10638964, 10670524, 10779504, 10884916, 11005214, 11016951, 11140692, 11248024, 11278645, 11509567, 11673464, 11713275, 11742035, 11747336, 11751884, 11792709, 11847524, 11931767, 11971970, 12163482, 12185081, 12218053, 12226080, 12368219, 12429819, 12441355, 12445232, 12482965, 12514133, 12539229, 12672951, 12682292, 12682377, 12700349, 12775722, 12799378, 12890669, 1425449, 14511406, 14573606, 14617803, 14662799, 14691288, 14695896, 14764990, 14966121, 14985354, 15001675, 15029260, 15310009, 15328534, 15330195, 15525515, 15536203, 15570555, 15583694, 15598662, 15672864, 15790678, 15888205, 15897571, 16061480, 1631125, 16334148, 16361251, 16365032, 16461912, 16474850, 16580667, 16691616, 16763722, 16847812, 16870607, 17010675, 17043241, 17052974, 17073766, 17120196, 17178899, 17221841, 17233900, 17259348, 17299418, 17325745, 17336451, 17346688, 17383188, 17387273, 17416342, 17433535, 17505061, 17522055, 17553164, 17553165, 17566103, 17581945, 17585029, 17595765, 17615153, 17634427, 17679089, 17696745, 17712477, 17728259, 17932034, 17935158, 17970072, 17975021, 17986787, 18007998, 18037956, 18084622, 18087039, 18156210, 18202547, 18202763, 18217192, 18218096, 18270433, 18302198, 18356297, 18372911, 18383880, 18415709, 18451096, 18472959, 18478162, 18479901, 18497079, 18504439, 18516299, 18519708, 18541154, 18602367, 18621129, 18623111, 18627423, 18632612, 18668523, 18687691, 18703514, 18708348, 18714395, 18719366, 18723482, 18726991, 18762779, 18765525, 18776922, 18782595, 18787043, 18794135, 18794799, 18819102, 18827407, 18958349, 18978937, 18997859, 19010821, 19055752, 19058140, 19079343, 19117982, 19131511, 19151763, 19153072, 19164447, 19244047, 19257827, 19276271, 19277043, 19318561, 19318562, 19351840, 19351848, 19366804, 19366833, 19420015, 19458261, 19460858, 19477425, 19491261, 19520769, 19584240, 19596919, 19632176, 19668381, 19706771, 19737972, 19790232, 19884383, 19901020, 19901962, 19956729, 20007693, 20023417, 20023700, 20043082, 20053773, 20061791, 20066006, 20080885, 20098441, 20102617, 20110352, 20126616, 20159994, 20173765, 20181722, 20200161, 20208536, 20219091, 20338164, 20388792, 20460526, 20478527, 20534771, 20571066, 20581083, 20606040, 20675041, 20807808, 20812024, 20932825, 20952028, 20959290, 20976069, 21031436, 21036700, 21047772, 21075385, 21088497, 21089003, 21147815, 21169411, 21177307, 21178266, 21212260, 21224358, 21248069, 21258401, 21267466, 21281786, 21308711, 21308712, 21310825, 21324924, 21330406, 21364123, 21364676, 21368866, 21372825, 21385481, 21393425, 21448923, 21454491, 21506119, 21525791, 21541972, 21552559, 21596021, 21602269, 21630295, 21652578, 21671247, 21680704, 21705451, 21773856, 21784672, 21796654, 21829708, 21871886, 21885566, 21909421, 21915096, 21949845, 21952621, 21956655, 21960693, 21963499, 21965718, 21969603, 21980429, 21986944, 22083957, 22114732, 22128178, 22131877, 22174412, 22179832, 22194994, 22245379, 22280402, 22306736, 22310230, 22344698, 22360658, 22383394, 22403175, 22403609, 22411952, 22462810, 22473899, 22496618, 22505583, 22507964, 22508765, 22509301, 22531786, 22540830, 22547569, 22589544, 22592999, 22610119, 22623731, 22653923, 22665440, 22693258, 22699815, 22722839, 22761715, 22808286, 22821817, 22829593, 22864060, 22871957, 22879989, 22890844, 22894932, 22986532, 23019221, 23041672, 23041906, 23056207, 23056316, 23095762, 23106833, 23109869, 23113536, 23117885, 23130941, 23145034, 23159636, 23171135, 23187804, 23209612, 23233736, 23246967, 23266674, 23320115, 23321516, 23341456, 23349811, 23363843, 23369005, 23389878, 23426362, 23437213, 23493267, 23493350, 23503464, 23559371, 23573315, 23576568, 23580326, 23658830, 23661607, 23674566, 23699654, 23704919, 23713567, 23724116, 23744763, 23798432, 23813697, 23814488, 23840433, 23877345, 23887938, 23922223, 23945560, 23997240, 24098661, 24129850, 24130878, 24167630, 24169353, 24173286, 24207095, 24236111, 24258347, 24292680, 24305618, 24338950, 24347472, 24379448, 24387052, 24423874, 24437490, 24466341, 24481405, 24507681, 24508459, 24564736, 24573652, 24574517, 24618694, 24634161, 24647988, 24659479, 24694733, 24705864, 24739041, 24759584, 24779793, 24820830, 24824408, 24845031, 24874833, 24875621, 24882718, 24887556, 24913494, 24925052, 24925673, 24943499, 24948871, 24948876, 24948877, 24969063, 24972028, 24981513, 25003216, 25008967, 25031707, 25065656, 25080090, 25103771, 25132238, 25172328, 25175748, 25203674, 25214070, 25216853, 25220414, 25241147, 25252916, 25268119, 25274033, 25285958, 25296973, 25307492, 25327559, 25329375, 25344584, 25360799, 25409505, 25415230, 25432158, 25532583, 25535248, 25537508, 25547524, 25552366, 25552417, 25568070, 25592066, 25605250, 25605930, 25631036, 25658610, 25669987, 25693800, 25700553, 25730905, 25772238, 25793207, 25829060, 25846647, 25851605, 25869206, 25907805, 25943311, 25950519, 25969144, 26017567, 26035357, 26036626, 26052153, 26052614, 26056150, 26152357, 26154658, 26175158, 26176602, 26181434, 26195723, 26206497, 26235179, 26250344, 26257066, 26257301, 26264969, 26310125, 26332122, 26336104, 26336819, 26353013, 26364608, 26371515, 26378018, 26411452, 26411689, 26412853, 26429394, 26443432, 26461474, 26462181, 26527750, 26537258, 26544944, 26553749, 26554309, 26558456, 26560244, 26572708, 26573794, 26649804, 26658102, 26694952, 26751772, 26813233, 26855148, 26876983, 26907477, 26934861, 26945682, 26960690, 26965862, 26986969, 27003515, 27026295, 27028864, 27049720, 27053681, 27063447, 27072221, 27117751, 27185910, 27206800, 27220053, 27223260, 27225190, 27248322, 27268279, 27292025, 27300431, 27341831, 27342777, 27363033, 27365400, 27374083, 27378372, 27486973, 27527157, 27539393, 27598125, 27606620, 27623747, 27628492, 27641228, 27669432, 27671337, 27672034, 27683042, 27693493, 27699828, 27702818, 27729622, 27760327, 27787597, 27793987, 27835608, 27853318, 27897170, 27902483, 27906189, 27916435, 27977328, 28032932, 28035996, 28038451, 28039468, 28050800, 28055971, 28059768, 28062857, 28069826, 28077787, 28129131, 28151478, 28151719, 28169398, 28176139, 28205582, 28212551, 28235401, 28257035, 28270124, 28338058, 28359301, 28380417, 28412251, 28415632, 28415728, 28416760, 28426320, 28442907, 28473535, 28474805, 28489571, 28494073, 28498319, 28507054, 28511652, 28536143, 28582660, 28596572, 28600675, 28607007, 28609657, 28611094, 28611215, 28671964, 28691182, 28718667, 28724614, 28775145, 28826481, 28851861, 28901514, 28912144, 28928128, 28981526, 29076496, 29116202, 29121144, 29138500, 29138507, 29154974, 29170510, 29206234, 29207031, 29225078, 29249638, 29257308, 29269934, 29286483, 29288523, 29289429, 29332354, 29353883, 29378906, 29429990, 29431615, 29436611, 29453313, 29527701, 29574703, 29581250, 29588330, 29658587, 29662164, 29670000, 29749458, 29758263, 29773186, 29784665, 29808028, 29808619, 29891490, 29909987, 29934310, 29949537, 29966326, 29985747, 29988112, 30009471, 30028845, 30033370, 30058677, 30085300, 30108134, 30115758, 30134822, 30139231, 30142696, 30232224, 30237440, 30280407, 30297360, 30365107, 30367117, 30367578, 30382885, 30410767, 30458854, 30464211, 30537509, 30577860, 30606742, 30606771, 30626627, 30644358, 30664187, 30664691, 30693539, 30702443, 30763921, 30808729, 30827887, 30828077, 30833300, 30846826, 30859654, 30905075, 30992362, 31006810, 31043708, 31057123, 31068457, 31081050, 31097763, 31110158, 31201297, 31221168, 31221986, 31228231, 31288377, 31294131, 31295943, 31310591, 31370197, 31376206, 31405024, 31444154, 31454442, 31470217, 31501416, 31503366, 31515456, 31515496, 31530569, 31581661, 31604846, 31629421, 31647098, 31727962, 31730277, 31736422, 31819114, 31855178, 31857319, 31901908, 31932493, 31967940, 31980029, 32044806, 32057540, 32091413, 32094488, 32123273, 32198489, 32220959, 32297439, 32333502, 32358577, 32376689, 32412125, 32413024, 32459381, 32466878, 32485222, 32579110, 32681068, 32686647, 32690948, 32692871, 32692888, 32694570, 32704143, 32823970, 32846021, 32879302, 32908142, 32931739, 33034050, 33050986, 33152908, 33185915, 33219721, 33258506, 33293427, 33300995, 33303959, 33323969, 33326447, 33390843, 33430890, 33446905, 33451122, 33470049, 33500395, 33513133, 33522043, 33563753, 33576154, 33755225, 33795839, 33801338, 33822745, 33932081, 33933576, 33955576, 33974560, 33975627, 33976187, 33982774, 34050700, 34057812, 34165174, 34168263, 34193246, 34197212, 34211036, 34215720, 34256096, 34280123, 34312180, 34315855, 34321613, 34322653, 34382934, 34439818, 34450249, 34475205, 34489572, 34516499, 34568716, 34570813, 34581895, 34625422, 34667276, 34672379, 34697370, 34698359, 34728570, 34737261, 34785213, 34864989, 34889941, 34911936, 34919781, 34939643, 34948018, 34973338, 34986150, 34998793, 35007362, 35011576, 35014621, 35058329, 35087237, 35121110, 35122875, 35162969, 35163481, 35196489, 35219875, 35269731, 35302608, 35317841, 35333400, 35333596, 35348747, 35365763, 35405009, 35418689, 35428760, 35447082, 35456428, 35468964, 35477723, 35509021, 35512605, 35536859, 35562350, 35584120, 35590370, 35612714, 35695870, 35731919, 35776912, 35785414, 35811549, 35864178, 35866337, 35905714, 35943799, 35944897, 35963852, 35975362, 35998026, 36008945, 36043441, 36065066, 36071171, 36112348, 36129942, 36149194, 36169095, 36171234, 36175875, 36245843, 36251994, 36259569, 36293081, 36300627, 36302916, 36316045, 36335093, 36430833, 36446804, 36450752, 36453547, 36479732, 36535377, 36577061, 36583514, 36611918, 36613955, 36623445, 36647826, 36656639, 36657982, 36662227, 36682291, 36720643, 36727462, 36773708, 36779357, 36809527, 36824501, 36834705, 36877164, 36893587, 36921044, 36949059, 36978046, 36988133, 36994854, 37038004, 37047218, 37065756, 37073437, 37077937, 37142586, 37155905, 37160910, 37169162, 37282383, 37295433, 37326412, 37352376, 37375297, 37380074, 37385752, 37452083, 37478850, 37488766, 37520743, 37546702, 37549772, 37552603, 37563129, 37563360, 37596305, 37643783, 37644036, 37644825, 37725435, 37751307, 37794090, 37796107, 37828515, 37847647, 37875732, 37882449, 37888771, 37889103, 37892208, 37903548, 37939374, 37958994, 37988848, 38015476, 38049622, 38091676, 38104728, 38113006, 38131188, 38214432, 38238517, 38376283, 38427749, 38522838, 39253786, 39261236, 39265220, 39300962, 39529201, 39596257, 40133664, 40181402, 40558274, 7493915, 7512791, 7720667, 7723794, 7929269, 8049525, 8292051, 8643607, 8662737, 9016528, 9096391, 9636157, 9675141, 9736693	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10482183, 10580840, 10629558, 10688034, 10815917, 10835690, 10953159, 11280747, 11306464, 11585771, 11684838, 11830526, 11857028, 11857595, 12083956, 12860943, 12884364, 14619959, 14654929, 15131260, 15166229, 1562539, 16598769, 17045208, 17055720, 17079466, 17185378, 17221842, 17234809, 17477366, 17634427, 17909000, 17925854, 18163430, 18174752, 18469090, 18571420, 18639541, 18723670, 19118031, 19152342, 19258514, 19289629, 19653278, 19794963, 19838047, 19901020, 19946123, 20007693, 20204290, 20470445, 20634343, 21267466, 21310825, 21350948, 21602788, 21795710, 21982950, 22085526, 22175694, 22179832, 22245379, 22275114, 22447389, 22761715, 2285596, 2322591, 23272133, 23658830, 23811619, 23851510, 24037531, 24349321, 25007053, 25138562, 25277175, 25277659, 25356728, 25693195, 26056150, 26083457, 26457646, 26553749, 26685282, 26797685, 26945682, 27365400, 28181678, 28209757, 28324007, 28473532, 28783103, 29051161, 29206234, 29402932, 29765513, 29844167, 30027545, 30028845, 30142696, 30185422, 30190514, 30763756, 30859654, 31273254, 31760376, 9773979, 9816170		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11719440, 11751884, 11856748, 11927493, 11967956, 11971970, 12083956, 12226080, 12376473, 12394768, 12465595, 12482965, 12569365, 12949936, 12970746, 14511406, 14612401, 14662770, 14743468, 14744796, 14966297, 14981536, 15013685, 15131260, 15156193, 15205473, 15350307, 15361837, 15368471, 15389799, 15558026, 15570555, 15585562, 15617028, 15640154, 15754350, 15790678, 15827323, 15833816, 15887248, 15900601, 15919721, 15948728, 16254899, 16278385, 16384856, 16461912, 16479009, 16494870, 16865726, 16914734, 16969502, 16969583, 17015840, 17043241, 17055455, 17073759, 17082327, 17178871, 17178887, 17242169, 17257635, 17334587, 17342749, 17356171, 17376218, 17426252, 17476687, 17494760, 17503469, 17540719, 17541959, 17553795, 17563746, 17569297, 17585029, 17634427, 17696745, 17704139, 17712477, 17728259, 17906287, 17914092, 17932034, 17972531, 17975004, 17991730, 18084330, 18084622, 18172316, 18174258, 18178153, 18181049, 18196538, 18217192, 18266956, 18324648, 18372911, 18413735, 18451177, 18469090, 18471792, 18479901, 18511414, 18516299, 18559568, 18593950, 18602367, 18694745, 18703514, 18726991, 18776922, 18780293, 18952763, 18958349, 18977589, 19147544		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	11742035, 12237244, 15389811, 15790600, 16266977, 16877366, 16934689, 16998812, 17003774, 17141945, 18829485, 19011039, 20729295, 22610119, 22666205, 23704919, 25062956, 25735316, 25908785, 25970160, 29610475		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22014572, 32512818, 33463130	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25512540, 30958616, 31054895, 31756402, 32343676, 32560654	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms, Castration-Resistant	Prostatic Neoplasms, Castration-Resistant	CTD_human_DG	18985049, 24740322, 28500234, 28757136		★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	23620238		★☆☆☆☆ Found in Text Mining only
Protanomaly	Protanomaly	BEFREE	9822653		★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	CTD_human_DG	15902657		★☆☆☆☆ Found in Text Mining only
Pseudovaginal Perineoscrotal Hypospadias	5-alpha reductase deficiency	BEFREE	20132346, 6480803		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15186320, 15793282, 20938960, 30323299, 8980296, 9410906		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	15955087		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27561911, 30111857	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15696083, 19915156, 30968186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	26817844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyelonephritis	Pyelonephritis	BEFREE	30041870		★☆☆☆☆ Found in Text Mining only
Pyloric Stenosis, Hypertrophic	Congenital hypertrophic pyloric stenosis	BEFREE	12519373		★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	BEFREE	28198660, 28985715, 29358674, 29763914, 31086273, 31573454		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	16425262, 25026457		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	10049048		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	7772520		★☆☆☆☆ Found in Text Mining only
Reifenstein Syndrome	Reifenstein Syndrome	UNIPROT_DG	10022458, 10221692, 10470409, 10502786, 10543676, 11587068, 1303262, 1307250, 1316540, 1424203, 1430233, 14756668, 2010552, 7581399, 7649358, 7671849, 7909256, 7910529, 7929841, 7970939, 7981687, 8033918, 8097257, 8126121, 8205256, 8281139, 8325932, 8325950, 8446106, 8550758, 8809734, 8823308, 8824883, 9039340, 9196614, 9302173, 9329414, 9543136, 9607727, 9768671, 9856504		★☆☆☆☆ Found in Text Mining only
Reifenstein Syndrome	Reifenstein Syndrome	BEFREE	10221692, 10502786, 10617653, 10971094, 10999818, 1303262, 1356901, 1424203, 1472458, 15001585, 15053245, 15452386, 15963062, 1598912, 16151980, 16448442, 1683208, 17488792, 17937062, 18656523, 19601939, 19851057, 20132346, 20305676, 20333878, 20410220, 22412043, 24186597, 24366239, 26845730, 27087292, 27403927, 27583472, 28456808, 29267169, 29396419, 30316867, 30787207, 3106178, 3521447, 6332533, 7649358, 7910529, 8099270, 8128958, 8246999, 8325932, 8446106, 8546149, 8550758, 8784104, 8823308, 8824883, 8961263, 8980896, 9010714, 9156036, 9177411, 9196614, 9245853, 9345099, 9519369, 9543136, 9607727, 9768671, 9886845		★☆☆☆☆ Found in Text Mining only
Reifenstein Syndrome	Reifenstein Syndrome	CTD_human_DG	1303262, 8281139		★☆☆☆☆ Found in Text Mining only
Reifenstein Syndrome	Reifenstein Syndrome	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Reifenstein Syndrome	Reifenstein Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15358199, 23460808, 25796113, 26304926, 26814892, 26973243, 27848972, 28107702, 28253524, 28644440, 29030639, 29108248, 29572225, 30919276, 31000693, 31110275		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28919491, 31676723		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	21598249, 26884344		★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 2 (disorder)	Retinitis Pigmentosa	BEFREE	30098699		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23853093, 25070358, 27760327, 29748904		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10419869, 10711573, 14570589, 17082220, 17431729, 19555469, 20346245, 21997404, 22040886, 22089459, 22251404, 27355582		★☆☆☆☆ Found in Text Mining only
Salivary Gland Adenoma Pleomorphic	Salivary gland disease	Pubtator	20711118, 37247295	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	24618694, 28681314, 29211833, 29385707, 32310325, 34232601	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	19672785, 29588330		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	26076995, 34543357, 39349354, 9301550, 9653174	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	20610535	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16112495, 28359301, 31446215, 8291571, 8546149		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	28359301	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	37310903	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	17426641, 30485184, 31009471, 31022152		★☆☆☆☆ Found in Text Mining only
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	30027448		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	24930483, 34043754	Associate	★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	11286615		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	17664471, 19738126, 21283802, 24114668, 25520391, 25707609, 26284333, 26341080, 27272216, 27344184, 31519572		★☆☆☆☆ Found in Text Mining only
Secondary physiologic amenorrhea	Secondary Physiologic Amenorrhea	BEFREE	17431892		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	31414730	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	21642359		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	21642359	Associate	★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	38195661	Stimulate	★☆☆☆☆ Found in Text Mining only
Sertoli Cell Tumor	Sertoli Cell Tumor	BEFREE	11293168, 9332480		★☆☆☆☆ Found in Text Mining only
Sertoli-Leydig Cell Tumor	Sertoli-Leydig Cell Tumor	BEFREE	17852420		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	19178528, 19330472, 19851057, 20150575, 21161538, 24186597, 25241384, 26197461, 26303084, 27583472, 28545802, 31429517, 7909666, 8550758, 9255042		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	25707609, 29972220	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	20938960		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	26888452	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	26888452		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	29211833	Associate	★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	26888452		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24777847		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	17137601, 20840067		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	LHGDN	17997416		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	17868456, 27520369		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 8	Spinocerebellar Ataxia	BEFREE	12042281		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	11356158, 8190020, 8541843, 9020849		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	9217976		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	12065781		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	17904846		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	11237771		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12324705, 17533397, 25862847, 30395538, 31239703, 31485602		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12743035		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11712819, 12925954, 25724186, 27801498		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21781458, 23625689, 34290392, 34859260, 38157249	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28892046		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18980991, 24351425, 25762634, 25862847, 27004400, 28723928, 30302873		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11297235, 21482691, 23199240, 23414681, 25203737, 25301736, 26884344, 27713123, 28256068, 30737779, 31413736, 31466817, 31566139, 8407551		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14963700		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15723263, 15940630, 16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 23199240, 25203737, 26206497, 26884344, 27432879, 27893427, 28256068, 28388558, 31466817, 31759122, 37431884, 37806457, 39354571, 8407551	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	27713123	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	23468366	Associate	★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	10935543, 31393859		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	23710174		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	25047002		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	15186320		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27355582		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	23958352		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	14532843		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	23363843, 26336104	Associate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	26355245		★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	19937586, 20198568		★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	Pubtator	19937586, 20198568	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	16950754, 33741265, 37058074	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	10221770, 10323385, 10323411, 10404311, 10428170, 10599549, 10711573, 10727996, 10834333, 11144509, 11185742, 11225909, 11260228, 11293168, 11380707, 11396657, 11744994, 12519373, 12573815, 12638777, 12641825, 12838569, 1316540, 1347772, 13680382, 1426313, 1480178, 1487249, 14974091, 1508223, 15118070, 1569163, 15724799, 15812177, 15813610, 15941919, 1609793, 16151980, 16388114, 16449235, 16470553, 16772330, 16794370, 16950754, 17011702, 17229664, 17408421, 1750490, 17714709, 17852420, 17937062, 18097502, 1856263, 18577874, 19463997, 19732585, 1999491, 20150575, 2050265, 20602105, 2082179, 20888558, 22487869, 22608796, 2311825, 23329762, 2333898, 23637914, 23729616, 24055831, 24186597, 25404712, 2594783, 25997614, 26592841, 27110943, 27583472, 27609317, 28299491, 28456808, 28613048, 28743543, 29118296, 30113450, 30165367, 30705665, 30825542, 30970592, 31012339, 3106178, 31283987, 3186717, 500829, 6602545, 6748013, 7537149, 7626493, 7633398, 7641413, 8096390, 8224266, 8253718, 8281140, 8421085, 8574287, 8626869, 8732995, 8830623, 9039330, 9039995, 9156321, 9159192, 9177411, 9255042, 9296379, 9302173, 9328206, 9332480, 9360511, 9526703, 9544375, 9554754, 9610419, 9895128		★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	CTD_human_DG	1303262, 8281139		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	21642359, 30900623		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	21642359	Associate	★☆☆☆☆ Found in Text Mining only
Testicular gonadoblastoma	Testicular gonadoblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular hypogonadism	Testicular Hypogonadism	BEFREE	15956082, 3106395		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	11144509, 17437848, 9250171		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	11144509, 25180665, 27873769, 33741265	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	11166459, 12176877, 15710583, 22706669, 7786775		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	11166459, 16299230		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	11166459	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	LHGDN	16299230		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	31401665		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22386953		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	22386953		★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	12888829, 1430233, 29118296	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	11255259, 22386953, 22531679		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	9718012		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	36639835	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	14736285, 30483954		★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	34922802	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	15813610, 22698698, 2333898, 29949163, 6602545		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	29651273		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19531543, 19887463, 19921427, 22638807, 23373898, 23549873, 23582599, 23929266, 24505496, 24779793, 25208879, 25588857, 25743329, 26039245, 26051240, 26353837, 26552477, 26742006, 26757422, 27015557, 27120467, 27285752, 27514395, 29059676, 29099049, 29880907, 29883487, 29912871, 30175120, 30351863, 30570854, 30606771, 31005169, 31427547, 31603099, 31718606, 31822498, 32102539, 32332626, 32406563, 32677589, 32778063, 33208857, 33294922, 33352494, 33432555, 33660830, 33753865, 34159849, 34475205, 34768979, 34797837, 36157217, 36178912, 36230969, 36584207, 36826464, 36870308, 37074839, 37264313, 37796506, 37979170, 38105538, 39243111, 39769441, 39978376, 40596998, 40616536, 40685652	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	19921427, 23341456, 23373898, 23549873, 24155918, 24324816, 24346128, 24505496, 24779793, 25072326, 25103565, 25208879, 25310144, 25510351, 25695063, 25713333, 25973541, 26009308, 26039245, 26051240, 26172299, 26201402, 26353837, 26938985, 27137076, 27350136, 27401886, 27439682, 27456662, 27528625, 27994514, 28067809, 28194662, 28468774, 28474753, 28512248, 28555173, 28583190, 28766215, 28915596, 29033586, 29059676, 29069872, 29099049, 29100362, 29187427, 29202431, 29340907, 29373071, 29484502, 29489512, 29713287, 29807045, 29844570, 29844843, 29880907, 29902579, 29912871, 29940524, 29964098, 30210453, 30250564, 30279965, 30352905, 30416486, 30570854, 30594038, 30628926, 30783520, 30805773, 31005169, 31106385, 31319547, 31434793, 31527644, 31540486, 31563883		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	20507730	Inhibit	★☆☆☆☆ Found in Text Mining only
True Hermaphroditism (disorder)	True Hermaphroditism	BEFREE	11808880		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	29210800	Inhibit	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	29210800		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	10680293, 11808880, 12210339, 14642001, 18273818, 9176406		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	10680293, 18273818	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	LHGDN	18273818		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30425334		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	17365134, 17613104		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	15342401		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	25178641	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	14736285, 18845648, 21400613, 22922989, 25048477, 26517808, 26885620, 27322140, 28869948, 29659560, 30961575, 31119584, 33549708, 33797847, 34576193, 36720985, 36800968, 37668795, 37762034, 38193232	Associate	★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	38197270, 8097257, 8099270	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	11564035		★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	27635763, 38423597	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	17922225, 18845648, 21617230, 26044568, 27730305, 29592878, 30831560, 30864720, 31006613		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	36951594	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26210472	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	9094973	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10601839, 15704521, 20951201, 26342051, 31761932, 7529041, 8049142, 9176406		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	16357844	Inhibit	★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	20579135, 23201383		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	12869389	Associate	★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	30810814		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	30577860	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	31553790		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31083690		★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	8863165		★☆☆☆☆ Found in Text Mining only
Vitamin K Deficiency	Vitamin k deficiency	Pubtator	17699110	Stimulate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	12112314		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	7537115		★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	7829103		★☆☆☆☆ Found in Text Mining only
X-Linked Emery-Dreifuss Muscular Dystrophy	Emery-Dreifuss Muscular Dystrophy, X-Linked	BEFREE	31718017		★☆☆☆☆ Found in Text Mining only
X-linked retinitis pigmentosa	Retinitis Pigmentosa, X-Linked	BEFREE	30098699		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	21157430	Associate	★☆☆☆☆ Found in Text Mining only
XX males	XX Males	BEFREE	17579198		★☆☆☆☆ Found in Text Mining only