TRIM23 (tripartite motif containing 23)

Gene

• Entrez ID: 373
• Gene name: Tripartite motif containing 23
• Gene symbol: TRIM23
• Synonyms (NCBI Gene): ARD1, ARFD1, RNF46
• Chromosome: 5
• Chromosome location: 5q12.3
• Summary: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021830	hsa-miR-132-3p	Microarray	17612493
MIRT024310	hsa-miR-215-5p	Microarray	19074876
MIRT026946	hsa-miR-192-5p	Microarray	19074876
MIRT028184	hsa-miR-33a-5p	Sequencing	20371350
MIRT040741	hsa-miR-455-5p	CLASH	23622248
MIRT520469	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT520468	hsa-miR-586	HITS-CLIP	21572407
MIRT698078	hsa-miR-5009-3p	HITS-CLIP	21572407
MIRT216289	hsa-miR-324-5p	HITS-CLIP	21572407
MIRT520467	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520466	hsa-miR-6083	HITS-CLIP	21572407
MIRT520465	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT520469	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT520468	hsa-miR-586	HITS-CLIP	23313552
MIRT698078	hsa-miR-5009-3p	HITS-CLIP	23313552
MIRT216289	hsa-miR-324-5p	HITS-CLIP	23313552
MIRT520467	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT520466	hsa-miR-6083	HITS-CLIP	23313552
MIRT520465	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT520469	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT520468	hsa-miR-586	PAR-CLIP	20371350
MIRT216289	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT520467	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT520466	hsa-miR-6083	PAR-CLIP	20371350
MIRT520465	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT520469	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT520468	hsa-miR-586	PAR-CLIP	21572407
MIRT553391	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT216289	hsa-miR-324-5p	PAR-CLIP	21572407
MIRT520467	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520466	hsa-miR-6083	PAR-CLIP	21572407
MIRT520465	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT520469	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT520468	hsa-miR-586	PAR-CLIP	23446348
MIRT216289	hsa-miR-324-5p	PAR-CLIP	23446348
MIRT520467	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520466	hsa-miR-6083	PAR-CLIP	23446348
MIRT520465	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT726233	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT726234	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT726232	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT726230	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT726231	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT726229	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT726228	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT520469	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT520468	hsa-miR-586	HITS-CLIP	21572407
MIRT698078	hsa-miR-5009-3p	HITS-CLIP	21572407
MIRT216289	hsa-miR-324-5p	HITS-CLIP	21572407
MIRT520467	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520466	hsa-miR-6083	HITS-CLIP	21572407
MIRT520465	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT520469	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT520468	hsa-miR-586	HITS-CLIP	23313552
MIRT698078	hsa-miR-5009-3p	HITS-CLIP	23313552
MIRT216289	hsa-miR-324-5p	HITS-CLIP	23313552
MIRT520467	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT520466	hsa-miR-6083	HITS-CLIP	23313552
MIRT520465	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT520469	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT520468	hsa-miR-586	PAR-CLIP	20371350
MIRT216289	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT520467	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT520466	hsa-miR-6083	PAR-CLIP	20371350
MIRT520465	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT520469	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT520468	hsa-miR-586	PAR-CLIP	21572407
MIRT553391	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT216289	hsa-miR-324-5p	PAR-CLIP	21572407
MIRT520467	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520466	hsa-miR-6083	PAR-CLIP	21572407
MIRT520465	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT520469	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT520468	hsa-miR-586	PAR-CLIP	23446348
MIRT216289	hsa-miR-324-5p	PAR-CLIP	23446348
MIRT520467	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520466	hsa-miR-6083	PAR-CLIP	23446348
MIRT520465	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1453359	hsa-miR-1238	CLIP-seq
MIRT1453360	hsa-miR-1305	CLIP-seq
MIRT1453361	hsa-miR-141	CLIP-seq
MIRT1453362	hsa-miR-155	CLIP-seq
MIRT1453363	hsa-miR-200a	CLIP-seq
MIRT1453364	hsa-miR-224	CLIP-seq
MIRT1453365	hsa-miR-30a	CLIP-seq
MIRT1453366	hsa-miR-30b	CLIP-seq
MIRT1453367	hsa-miR-30c	CLIP-seq
MIRT1453368	hsa-miR-30d	CLIP-seq
MIRT1453369	hsa-miR-30e	CLIP-seq
MIRT1453370	hsa-miR-3119	CLIP-seq
MIRT1453371	hsa-miR-3622a-5p	CLIP-seq
MIRT1453372	hsa-miR-377	CLIP-seq
MIRT1453373	hsa-miR-3922-5p	CLIP-seq
MIRT1453374	hsa-miR-3942-5p	CLIP-seq
MIRT1453375	hsa-miR-4257	CLIP-seq
MIRT1453376	hsa-miR-4420	CLIP-seq
MIRT1453377	hsa-miR-4423-3p	CLIP-seq
MIRT1453378	hsa-miR-4427	CLIP-seq
MIRT1453379	hsa-miR-4452	CLIP-seq
MIRT1453380	hsa-miR-4495	CLIP-seq
MIRT1453381	hsa-miR-4703-5p	CLIP-seq
MIRT1453382	hsa-miR-4709-5p	CLIP-seq
MIRT1453383	hsa-miR-4766-5p	CLIP-seq
MIRT1453384	hsa-miR-498	CLIP-seq
MIRT1453385	hsa-miR-5096	CLIP-seq
MIRT1453386	hsa-miR-518d-5p	CLIP-seq
MIRT1453387	hsa-miR-519b-5p	CLIP-seq
MIRT1453388	hsa-miR-519c-5p	CLIP-seq
MIRT1453389	hsa-miR-520c-5p	CLIP-seq
MIRT1453390	hsa-miR-526a	CLIP-seq
MIRT1453391	hsa-miR-539	CLIP-seq
MIRT1453392	hsa-miR-548c-3p	CLIP-seq
MIRT1453393	hsa-miR-568	CLIP-seq
MIRT1453394	hsa-miR-580	CLIP-seq
MIRT1453395	hsa-miR-28-5p	CLIP-seq
MIRT1453396	hsa-miR-3139	CLIP-seq
MIRT1453397	hsa-miR-369-3p	CLIP-seq
MIRT1453398	hsa-miR-374c	CLIP-seq
MIRT1453399	hsa-miR-4719	CLIP-seq
MIRT1453400	hsa-miR-4766-3p	CLIP-seq
MIRT1453401	hsa-miR-520d-5p	CLIP-seq
MIRT1453402	hsa-miR-524-5p	CLIP-seq
MIRT1453391	hsa-miR-539	CLIP-seq
MIRT1453403	hsa-miR-561	CLIP-seq
MIRT1453394	hsa-miR-580	CLIP-seq
MIRT1453404	hsa-miR-655	CLIP-seq
MIRT1453405	hsa-miR-708	CLIP-seq
MIRT2135857	hsa-miR-135a	CLIP-seq
MIRT2135858	hsa-miR-135b	CLIP-seq
MIRT2135859	hsa-miR-142-5p	CLIP-seq
MIRT2135860	hsa-miR-3146	CLIP-seq
MIRT2135861	hsa-miR-340	CLIP-seq
MIRT2135862	hsa-miR-4269	CLIP-seq
MIRT2135863	hsa-miR-4502	CLIP-seq
MIRT2135864	hsa-miR-4514	CLIP-seq
MIRT2135865	hsa-miR-4639-5p	CLIP-seq
MIRT2135866	hsa-miR-4692	CLIP-seq
MIRT2135867	hsa-miR-4742-5p	CLIP-seq
MIRT2135868	hsa-miR-4762-3p	CLIP-seq
MIRT2135869	hsa-miR-892a	CLIP-seq
MIRT2135870	hsa-miR-935	CLIP-seq
MIRT2356945	hsa-miR-128	CLIP-seq
MIRT2135857	hsa-miR-135a	CLIP-seq
MIRT2135858	hsa-miR-135b	CLIP-seq
MIRT2135859	hsa-miR-142-5p	CLIP-seq
MIRT2356946	hsa-miR-203	CLIP-seq
MIRT2356947	hsa-miR-27a	CLIP-seq
MIRT2356948	hsa-miR-27b	CLIP-seq
MIRT2356949	hsa-miR-323-3p	CLIP-seq
MIRT2135861	hsa-miR-340	CLIP-seq
MIRT2356950	hsa-miR-3591-5p	CLIP-seq
MIRT2356951	hsa-miR-3671	CLIP-seq
MIRT2356952	hsa-miR-4255	CLIP-seq
MIRT2135863	hsa-miR-4502	CLIP-seq
MIRT2356953	hsa-miR-4659a-3p	CLIP-seq
MIRT2356954	hsa-miR-4659b-3p	CLIP-seq
MIRT2356955	hsa-miR-4704-3p	CLIP-seq
MIRT2135868	hsa-miR-4762-3p	CLIP-seq
MIRT1453385	hsa-miR-5096	CLIP-seq
MIRT2356956	hsa-miR-513a-5p	CLIP-seq
MIRT2650516	hsa-miR-101	CLIP-seq
MIRT2650517	hsa-miR-1183	CLIP-seq
MIRT1453360	hsa-miR-1305	CLIP-seq
MIRT2650518	hsa-miR-144	CLIP-seq
MIRT1453395	hsa-miR-28-5p	CLIP-seq
MIRT2650519	hsa-miR-3129-3p	CLIP-seq
MIRT1453396	hsa-miR-3139	CLIP-seq
MIRT2135860	hsa-miR-3146	CLIP-seq
MIRT2650520	hsa-miR-3163	CLIP-seq
MIRT2356949	hsa-miR-323-3p	CLIP-seq
MIRT2356950	hsa-miR-3591-5p	CLIP-seq
MIRT2650521	hsa-miR-3606	CLIP-seq
MIRT2650522	hsa-miR-3647-3p	CLIP-seq
MIRT2650523	hsa-miR-3684	CLIP-seq
MIRT1453397	hsa-miR-369-3p	CLIP-seq
MIRT2650524	hsa-miR-374a	CLIP-seq
MIRT2650525	hsa-miR-374b	CLIP-seq
MIRT1453398	hsa-miR-374c	CLIP-seq
MIRT1453372	hsa-miR-377	CLIP-seq
MIRT2650526	hsa-miR-410	CLIP-seq
MIRT2356952	hsa-miR-4255	CLIP-seq
MIRT2135862	hsa-miR-4269	CLIP-seq
MIRT2650527	hsa-miR-4496	CLIP-seq
MIRT2135864	hsa-miR-4514	CLIP-seq
MIRT2650528	hsa-miR-4528	CLIP-seq
MIRT2135865	hsa-miR-4639-5p	CLIP-seq
MIRT2135866	hsa-miR-4692	CLIP-seq
MIRT1453399	hsa-miR-4719	CLIP-seq
MIRT2135867	hsa-miR-4742-5p	CLIP-seq
MIRT1453400	hsa-miR-4766-3p	CLIP-seq
MIRT2650529	hsa-miR-4789-5p	CLIP-seq
MIRT2650530	hsa-miR-4803	CLIP-seq
MIRT1453401	hsa-miR-520d-5p	CLIP-seq
MIRT1453402	hsa-miR-524-5p	CLIP-seq
MIRT1453391	hsa-miR-539	CLIP-seq
MIRT2650531	hsa-miR-548p	CLIP-seq
MIRT1453403	hsa-miR-561	CLIP-seq
MIRT2650532	hsa-miR-576-5p	CLIP-seq
MIRT1453394	hsa-miR-580	CLIP-seq
MIRT1453404	hsa-miR-655	CLIP-seq
MIRT1453405	hsa-miR-708	CLIP-seq
MIRT2135869	hsa-miR-892a	CLIP-seq
MIRT2650533	hsa-miR-921	CLIP-seq
MIRT2135870	hsa-miR-935	CLIP-seq
MIRT1453360	hsa-miR-1305	CLIP-seq
MIRT1453395	hsa-miR-28-5p	CLIP-seq
MIRT2650519	hsa-miR-3129-3p	CLIP-seq
MIRT1453396	hsa-miR-3139	CLIP-seq
MIRT2135860	hsa-miR-3146	CLIP-seq
MIRT2356949	hsa-miR-323-3p	CLIP-seq
MIRT2650521	hsa-miR-3606	CLIP-seq
MIRT1453397	hsa-miR-369-3p	CLIP-seq
MIRT2650524	hsa-miR-374a	CLIP-seq
MIRT2650525	hsa-miR-374b	CLIP-seq
MIRT1453398	hsa-miR-374c	CLIP-seq
MIRT1453372	hsa-miR-377	CLIP-seq
MIRT2135862	hsa-miR-4269	CLIP-seq
MIRT2135864	hsa-miR-4514	CLIP-seq
MIRT2650528	hsa-miR-4528	CLIP-seq
MIRT2135865	hsa-miR-4639-5p	CLIP-seq
MIRT2135866	hsa-miR-4692	CLIP-seq
MIRT1453399	hsa-miR-4719	CLIP-seq
MIRT2135867	hsa-miR-4742-5p	CLIP-seq
MIRT1453400	hsa-miR-4766-3p	CLIP-seq
MIRT2650529	hsa-miR-4789-5p	CLIP-seq
MIRT1453401	hsa-miR-520d-5p	CLIP-seq
MIRT1453402	hsa-miR-524-5p	CLIP-seq
MIRT2650531	hsa-miR-548p	CLIP-seq
MIRT1453403	hsa-miR-561	CLIP-seq
MIRT1453404	hsa-miR-655	CLIP-seq
MIRT1453405	hsa-miR-708	CLIP-seq
MIRT2135869	hsa-miR-892a	CLIP-seq
MIRT2650533	hsa-miR-921	CLIP-seq
MIRT2135870	hsa-miR-935	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	9671726
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003924	Function	GTPase activity	IDA	8700863
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	8473324
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	15684077
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 21516116, 22493164, 23088713, 24722188, 25416956, 25910212, 26871637, 29892012, 31391242, 31515488, 32296183, 32814053
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	8700863
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	28871090
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	9671726
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0008047	Function	Enzyme activator activity	TAS	8473324
GO:0008270	Function	Zinc ion binding	IEA
GO:0010508	Process	Positive regulation of autophagy	IDA	28871090
GO:0010508	Process	Positive regulation of autophagy	IDA	28871090
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0016567	Process	Protein ubiquitination	IDA	15684077
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019003	Function	GDP binding	IDA	8700863
GO:0042802	Function	Identical protein binding	IPI	16189514, 22493164, 25416956, 32296183
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	28871090
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

Other IDs

• MIM: 601747
• HGNC: 660
• e!Ensembl: ENSG00000113595

Protein

• UniProt ID: P36406
• Protein name: E3 ubiquitin-protein ligase TRIM23 (EC 2.3.2.27) (ADP-ribosylation factor domain-containing protein 1) (GTP-binding protein ARD-1) (RING finger protein 46) (RING-type E3 ubiquitin transferase TRIM23) (Tripartite motif-containing protein 23)
• Protein function: Acts as an E3 ubiquitin-protein ligase. Plays an essential role in autophagy activation during viral infection. Mechanistically, activates TANK-binding kinase 1/TBK1 by facilitating its dimerization and ability to phosphorylate the selective aut
• PDB: 5VZV, 5VZW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14634	zf-RING_5	30 → 77	zinc-RING finger domain	Domain
  PF00643	zf-B_box	123 → 168	B-box zinc finger	Domain
  PF00025	Arf	391 → 565	ADP-ribosylation factor family	Domain

• Sequence:

  MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCL
  TRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGIS
  GESIIRCDEDEAHLASVYCTVCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCSQ
  HQVHAIEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTF
  TEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAHTEHVPGTAENARSCIRAYFYDLHETLC
  RQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDDCRVVLAKQEI
  TRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTI
  LFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVD
  SSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRS
  WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA

• Sequence length: 574

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIM23-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	30278484		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16705796, 31677335		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22292636, 23550278, 30154412		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	22292636		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18325661		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31813105		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18325661		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	22292636		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23258102, 30054466		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22292636, 23550278, 30154412		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22315407, 30054487		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30477642		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30054466, 31813105		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31813105		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22261620, 30477642		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22315407, 30054487		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30477642		★☆☆☆☆ Found in Text Mining only