Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3727
Gene name	JunD proto-oncogene, AP-1 transcription factor subunit
Gene symbol	JUND
Synonyms (NCBI Gene)	AP-1
Chromosome	19
Chromosome location	19p13.11
Summary	The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative transla

257

Show/Hide all (257)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005354	hsa-miR-663a	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	20622002
MIRT005354	hsa-miR-663a	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	20622002
MIRT017287	hsa-miR-335-5p	Microarray	18185580
MIRT045282	hsa-miR-186-5p	CLASH	23622248
MIRT650156	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT650155	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT570207	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT570208	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT491190	hsa-miR-3185	PAR-CLIP	20371350
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	20371350
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT005354	hsa-miR-663a	PAR-CLIP	20371350
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT491186	hsa-miR-4271	PAR-CLIP	20371350
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT570206	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT491190	hsa-miR-3185	PAR-CLIP	23592263
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT005354	hsa-miR-663a	PAR-CLIP	23592263
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491186	hsa-miR-4271	PAR-CLIP	23592263
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT005354	hsa-miR-663a	Luciferase reporter assayWestern blot	27184257
MIRT005354	hsa-miR-663a	Luciferase reporter assayWestern blot	27184257
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	26701625
MIRT570206	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT005354	hsa-miR-663a	PAR-CLIP	26701625
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	26701625
MIRT650156	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT650155	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT570207	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT570208	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT491190	hsa-miR-3185	PAR-CLIP	20371350
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	20371350
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT005354	hsa-miR-663a	PAR-CLIP	20371350
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT491186	hsa-miR-4271	PAR-CLIP	20371350
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT570206	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT491190	hsa-miR-3185	PAR-CLIP	23592263
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT005354	hsa-miR-663a	PAR-CLIP	23592263
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491186	hsa-miR-4271	PAR-CLIP	23592263
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078220	hsa-miR-1321	CLIP-seq
MIRT1078221	hsa-miR-139-3p	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078225	hsa-miR-2110	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT1078227	hsa-miR-2116	CLIP-seq
MIRT1078228	hsa-miR-3121-3p	CLIP-seq
MIRT1078229	hsa-miR-3133	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078231	hsa-miR-3144-5p	CLIP-seq
MIRT1078232	hsa-miR-3150a-3p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT1078234	hsa-miR-3175	CLIP-seq
MIRT1078235	hsa-miR-3177-5p	CLIP-seq
MIRT1078236	hsa-miR-3183	CLIP-seq
MIRT1078237	hsa-miR-3189-3p	CLIP-seq
MIRT1078238	hsa-miR-3664-5p	CLIP-seq
MIRT1078239	hsa-miR-375	CLIP-seq
MIRT1078240	hsa-miR-3921	CLIP-seq
MIRT1078241	hsa-miR-4436b-3p	CLIP-seq
MIRT1078242	hsa-miR-4487	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078244	hsa-miR-4532	CLIP-seq
MIRT1078245	hsa-miR-4653-5p	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT1078247	hsa-miR-4659a-3p	CLIP-seq
MIRT1078248	hsa-miR-4659b-3p	CLIP-seq
MIRT1078249	hsa-miR-4677-5p	CLIP-seq
MIRT1078250	hsa-miR-4682	CLIP-seq
MIRT1078251	hsa-miR-4688	CLIP-seq
MIRT1078252	hsa-miR-4707-3p	CLIP-seq
MIRT1078253	hsa-miR-4723-3p	CLIP-seq
MIRT1078254	hsa-miR-4724-5p	CLIP-seq
MIRT1078255	hsa-miR-4728-5p	CLIP-seq
MIRT1078256	hsa-miR-4731-3p	CLIP-seq
MIRT1078257	hsa-miR-4739	CLIP-seq
MIRT1078258	hsa-miR-4740-3p	CLIP-seq
MIRT1078259	hsa-miR-4756-5p	CLIP-seq
MIRT1078260	hsa-miR-4761-3p	CLIP-seq
MIRT1078261	hsa-miR-4787-3p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078263	hsa-miR-4801	CLIP-seq
MIRT1078264	hsa-miR-4803	CLIP-seq
MIRT1078265	hsa-miR-486-3p	CLIP-seq
MIRT1078266	hsa-miR-494	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078269	hsa-miR-548aa	CLIP-seq
MIRT1078270	hsa-miR-548ac	CLIP-seq
MIRT1078271	hsa-miR-548b-3p	CLIP-seq
MIRT1078272	hsa-miR-548d-3p	CLIP-seq
MIRT1078273	hsa-miR-548p	CLIP-seq
MIRT1078274	hsa-miR-548z	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078276	hsa-miR-602	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT1078278	hsa-miR-939	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078221	hsa-miR-139-3p	CLIP-seq
MIRT2019494	hsa-miR-1908	CLIP-seq
MIRT2019495	hsa-miR-1909	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT1078235	hsa-miR-3177-5p	CLIP-seq
MIRT2019496	hsa-miR-3180	CLIP-seq
MIRT2019497	hsa-miR-3180-3p	CLIP-seq
MIRT2019498	hsa-miR-3196	CLIP-seq
MIRT2019499	hsa-miR-3655	CLIP-seq
MIRT2019500	hsa-miR-4267	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT1078247	hsa-miR-4659a-3p	CLIP-seq
MIRT1078248	hsa-miR-4659b-3p	CLIP-seq
MIRT1078251	hsa-miR-4688	CLIP-seq
MIRT2019501	hsa-miR-4787-5p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078265	hsa-miR-486-3p	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078270	hsa-miR-548ac	CLIP-seq
MIRT1078272	hsa-miR-548d-3p	CLIP-seq
MIRT1078274	hsa-miR-548z	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078276	hsa-miR-602	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT2019502	hsa-miR-615-5p	CLIP-seq
MIRT2019503	hsa-miR-625	CLIP-seq
MIRT2019504	hsa-miR-663	CLIP-seq
MIRT2019505	hsa-miR-937	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT2251331	hsa-miR-1236	CLIP-seq
MIRT2019494	hsa-miR-1908	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT1078227	hsa-miR-2116	CLIP-seq
MIRT1078228	hsa-miR-3121-3p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT2019496	hsa-miR-3180	CLIP-seq
MIRT2019497	hsa-miR-3180-3p	CLIP-seq
MIRT2019498	hsa-miR-3196	CLIP-seq
MIRT1078238	hsa-miR-3664-5p	CLIP-seq
MIRT1078239	hsa-miR-375	CLIP-seq
MIRT2019500	hsa-miR-4267	CLIP-seq
MIRT1078241	hsa-miR-4436b-3p	CLIP-seq
MIRT1078247	hsa-miR-4659a-3p	CLIP-seq
MIRT1078248	hsa-miR-4659b-3p	CLIP-seq
MIRT1078249	hsa-miR-4677-5p	CLIP-seq
MIRT1078254	hsa-miR-4724-5p	CLIP-seq
MIRT1078258	hsa-miR-4740-3p	CLIP-seq
MIRT1078260	hsa-miR-4761-3p	CLIP-seq
MIRT2251332	hsa-miR-4768-5p	CLIP-seq
MIRT1078264	hsa-miR-4803	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078276	hsa-miR-602	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT2019502	hsa-miR-615-5p	CLIP-seq
MIRT2019503	hsa-miR-625	CLIP-seq
MIRT2019504	hsa-miR-663	CLIP-seq
MIRT2251333	hsa-miR-942	CLIP-seq
MIRT2389576	hsa-miR-1285	CLIP-seq
MIRT2389577	hsa-miR-1343	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT2389578	hsa-miR-3187-5p	CLIP-seq
MIRT2019499	hsa-miR-3655	CLIP-seq
MIRT2389579	hsa-miR-612	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078220	hsa-miR-1321	CLIP-seq
MIRT2554640	hsa-miR-151-5p	CLIP-seq
MIRT2554641	hsa-miR-151b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078228	hsa-miR-3121-3p	CLIP-seq
MIRT2554642	hsa-miR-3131	CLIP-seq
MIRT1078229	hsa-miR-3133	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078231	hsa-miR-3144-5p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT2554643	hsa-miR-3179	CLIP-seq
MIRT2019496	hsa-miR-3180	CLIP-seq
MIRT2019497	hsa-miR-3180-3p	CLIP-seq
MIRT2019498	hsa-miR-3196	CLIP-seq
MIRT2554644	hsa-miR-3613-3p	CLIP-seq
MIRT1078241	hsa-miR-4436b-3p	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT2554645	hsa-miR-4723-5p	CLIP-seq
MIRT1078255	hsa-miR-4728-5p	CLIP-seq
MIRT1078257	hsa-miR-4739	CLIP-seq
MIRT1078258	hsa-miR-4740-3p	CLIP-seq
MIRT1078259	hsa-miR-4756-5p	CLIP-seq
MIRT1078260	hsa-miR-4761-3p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078264	hsa-miR-4803	CLIP-seq
MIRT1078266	hsa-miR-494	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078271	hsa-miR-548b-3p	CLIP-seq
MIRT1078273	hsa-miR-548p	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT2554646	hsa-miR-611	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT1078278	hsa-miR-939	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078220	hsa-miR-1321	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078229	hsa-miR-3133	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078231	hsa-miR-3144-5p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT2554643	hsa-miR-3179	CLIP-seq
MIRT2554644	hsa-miR-3613-3p	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT2554645	hsa-miR-4723-5p	CLIP-seq
MIRT1078255	hsa-miR-4728-5p	CLIP-seq
MIRT1078257	hsa-miR-4739	CLIP-seq
MIRT1078259	hsa-miR-4756-5p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078271	hsa-miR-548b-3p	CLIP-seq
MIRT1078273	hsa-miR-548p	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT1078278	hsa-miR-939	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
MEN1	Repression	22327296
RBMX	Repression	16707624
ZIC1	Activation	20713527

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	22327296
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	TAS	1903194
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	1903194
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002076	Process	Osteoblast development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	9989505, 17577209, 20102225, 20195357, 22327296, 23784080, 24029232, 25609649, 26496610, 28514442, 30833792, 32814053, 33961781, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	1903194
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009416	Process	Response to light stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0017053	Component	Transcription repressor complex	IPI	22327296
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0032993	Component	Protein-DNA complex	IEA
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860
GO:0035976	Component	Transcription factor AP-1 complex	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10508860
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048545	Process	Response to steroid hormone	IBA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225
GO:1904321	Process	Response to forskolin	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
165162	6206	ENSG00000130522

P17535

Protein name

Transcription factor JunD (Transcription factor AP-1 subunit JunD)

Protein function

Transcription factor binding AP-1 sites (PubMed:9989505). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to an AP-1 consensus sequence 3'-TGA[GC]TCA-5' a

PDB

3U86 , 5VPA , 5VPB , 5VPC , 5VPD , 5VPE , 5VPF , 7UCC , 7UCD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03957	Jun	1 → 257	Jun-like transcription factor	Family
PF00170	bZIP_1	266 → 329	bZIP transcription factor	Coiled-coil

Sequence

METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

Sequence length

347

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Osteoclast differentiation IL-17 signaling pathway Parathyroid hormone synthesis, secretion and action		Estrogen-dependent gene expression NGF-stimulated transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (200)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22869147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18436711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16166335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22869147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18071306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	23482931, 27600282, 30066853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	20826579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37933012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	17518770		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21175428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20488324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23523566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	19008257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	20826579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30785199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17626252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23072510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11488985, 16452600, 31638834, 7500041, 7633872, 8541027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30572904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30785199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28824171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	17518770		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28233171		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	19064921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	31047984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25050631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10369069, 11891846, 14985464, 17637753, 22004728, 22132731, 23242121, 24073962, 8314777, 8597534, 9270011, 9658402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17166846, 21393445, 22988241, 28212576, 30337371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	18443593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	19470832	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23496845, 25332240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	18655788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19758438, 25271301, 28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18644981, 24659263, 25522777, 30382079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25050631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21847632, 9662339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36889906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11792626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27553367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17626252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11239196		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21496227, 23682787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10329043, 21496227, 23682787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22869147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36400758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19064921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28602698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31569788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15139522, 23210512, 30154407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14712303, 16259733, 16361535, 17510314, 21418301, 22489574, 27065323, 28381157, 30569725, 30591445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24151146, 26625825, 33413550, 35697349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12223450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21961038, 26903440, 28627596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28409880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11121152, 11912010, 24853951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	26251042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26599598, 31023625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26599598, 31023625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34801581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	34801581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26599598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27600282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	16100769, 30763715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	35941657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	24931237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11121152, 11912010, 24853951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11720885, 28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	17639289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29399113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19558549, 19758438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19558549, 19758438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28748534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12753293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	17133482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	14631383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10885623, 16849552, 19276385, 20467333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19276385, 27076368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10885623, 11778649, 16849552, 19276385, 30572904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	18443593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	LHGDN	18443593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	18443593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	19482216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21480395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27600282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11053476, 28478229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20430007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	29670181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10487833	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31025089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28409880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29208967, 29286093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	25961698, 27600282, 28659618, 29588546, 29597249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26860885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30659917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10845928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12082101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	12576324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12082101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21473742, 23247046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	15044019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17543481, 18644981, 21473287, 24659263, 25526895, 29731667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	17133482		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	28692045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	12424143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10823417, 27184257, 37894738	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27935865		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15322221, 16224536, 21757709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15507668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18494816, 23064464, 29597249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18494816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25734512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21480395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10369069, 14985464, 17407600, 17637753, 22004728, 22132731, 23242121, 24073962, 8314777, 8597534, 9270011, 9658402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11720885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19558549, 19758438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18644981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21847632, 9662339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27935865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19653276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27553367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19435822, 19887609, 22109562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12727841, 16199533, 16272172, 16964758, 19787273, 21743958, 28386843, 29758263, 31276688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20944126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14602779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25050631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10449779, 10924853, 16272172, 16784822, 17510397, 19057013, 19653276, 19850100, 20338993, 21892628, 21981137, 23828905, 24315690, 25260594, 25271301 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21496227, 23682787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15139522, 23210512, 30154407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18519796, 24073962, 24345432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17951536		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11251188, 12939465, 15492260, 9824619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14717848, 35926467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	20374154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23324604, 28155253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12969976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27890927, 31284669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29807388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12573143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	31456916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19158123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23496845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29017171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27076368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10449779, 10673028, 11108661, 11358840, 11570575, 11991252, 15554385, 16166335, 16412434, 17297470, 17363560, 17440073, 17846172, 18084253, 18454173 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16484283, 26734995, 31303139, 9218873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34312772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26445738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29017171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24411941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	9662339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30081074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29693149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27072870, 30001480		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27553367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19435822, 19887609, 22109562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17912030	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19435822, 36889906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30704487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	29670181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	16049073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	16049073, 22570239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28603286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12727841, 15486991, 16199533, 16272172, 16964758, 19787273, 21617851, 21743958, 28386843, 29758263, 31276688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12727841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20460526, 21622724, 21734453, 24647988, 26732163, 27358408, 30763715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16385345, 28502334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	23559854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	22265050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23583295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8649863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11037876, 26211509, 26362732, 27653023, 8649863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32977850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16125115, 29406423, 29935173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	18494816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	24465924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28751006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22853846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12393863, 20949447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	7984056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20944126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1331059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21515915, 22139817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14602779, 9690519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	24044365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14602779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31015574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31906413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21937452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	26908399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11889018, 31720303		★★★★★ ★☆☆☆☆ Found in Text Mining only

JUND (JunD proto-oncogene, AP-1 transcription factor subunit)