JAK1 (Janus kinase 1)

Gene

• Entrez ID: 3716
• Gene name: Janus kinase 1
• Gene symbol: JAK1
• Synonyms (NCBI Gene): AIIDE, JAK1A, JAK1B, JTK3
• Chromosome: 1
• Chromosome location: 1p31.3
• Summary: This gene encodes a membrane protein that is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. The encoded kinase phosphorylates STAT

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs151047872	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs869312953	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519753	C>A	Likely-pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000482	hsa-miR-17-5p	Luciferase reporter assay, Western blot	20299512
MIRT020460	hsa-miR-106b-5p	Microarray	17242205
MIRT021877	hsa-miR-128-3p	Microarray	17612493
MIRT046471	hsa-miR-15b-5p	CLASH	23622248
MIRT046312	hsa-miR-23b-3p	CLASH	23622248
MIRT053361	hsa-miR-9-5p	Microarray, qRT-PCR	23798388
MIRT020460	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25307786
MIRT020460	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25307786
MIRT054776	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot, Coimmunoprecipitation, Chromatin immunoprecipitation, Immunofluorescence microscopy	24429361
MIRT020460	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT031081	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT020460	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT000482	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727412	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT727411	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727410	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT031081	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT727408	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727409	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727407	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727406	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727405	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT731191	hsa-miR-373-3p	Immunoprecipitaion, qRT-PCR, Luciferase reporter assay, Western blot	25589644
MIRT731191	hsa-miR-373-3p	Immunoprecipitaion, qRT-PCR, Luciferase reporter assay, Western blot	25589644
MIRT727407	hsa-miR-30c-5p	Luciferase reporter assay	26826240
MIRT727407	hsa-miR-30c-5p	Luciferase reporter assay	26826240
MIRT000482	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), RNA-seq, qRT-PCR	32683798
MIRT737307	hsa-miR-126-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32554852
MIRT755646	hsa-miR-22-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37824732
MIRT727408	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR	38891028
MIRT1076007	hsa-miR-106a	CLIP-seq
MIRT1076008	hsa-miR-106b	CLIP-seq
MIRT1076009	hsa-miR-1179	CLIP-seq
MIRT1076010	hsa-miR-1245b-3p	CLIP-seq
MIRT1076011	hsa-miR-125a-3p	CLIP-seq
MIRT1076012	hsa-miR-1276	CLIP-seq
MIRT1076013	hsa-miR-1287	CLIP-seq
MIRT1076014	hsa-miR-1323	CLIP-seq
MIRT1076015	hsa-miR-142-5p	CLIP-seq
MIRT1076016	hsa-miR-148a	CLIP-seq
MIRT1076017	hsa-miR-148b	CLIP-seq
MIRT1076018	hsa-miR-152	CLIP-seq
MIRT1076019	hsa-miR-153	CLIP-seq
MIRT1076020	hsa-miR-1587	CLIP-seq
MIRT1076021	hsa-miR-17	CLIP-seq
MIRT1076022	hsa-miR-1825	CLIP-seq
MIRT1076023	hsa-miR-203	CLIP-seq
MIRT1076024	hsa-miR-2054	CLIP-seq
MIRT1076025	hsa-miR-20a	CLIP-seq
MIRT1076026	hsa-miR-20b	CLIP-seq
MIRT1076027	hsa-miR-299-3p	CLIP-seq
MIRT1076028	hsa-miR-30a	CLIP-seq
MIRT1076029	hsa-miR-30b	CLIP-seq
MIRT1076030	hsa-miR-30c	CLIP-seq
MIRT1076031	hsa-miR-30d	CLIP-seq
MIRT1076032	hsa-miR-30e	CLIP-seq
MIRT1076033	hsa-miR-3120-3p	CLIP-seq
MIRT1076034	hsa-miR-3124-3p	CLIP-seq
MIRT1076035	hsa-miR-3135b	CLIP-seq
MIRT1076036	hsa-miR-3149	CLIP-seq
MIRT1076037	hsa-miR-3164	CLIP-seq
MIRT1076038	hsa-miR-3173-3p	CLIP-seq
MIRT1076039	hsa-miR-3189-5p	CLIP-seq
MIRT1076040	hsa-miR-3192	CLIP-seq
MIRT1076041	hsa-miR-323-5p	CLIP-seq
MIRT1076042	hsa-miR-338-5p	CLIP-seq
MIRT1076043	hsa-miR-340	CLIP-seq
MIRT1076044	hsa-miR-3529	CLIP-seq
MIRT1076045	hsa-miR-3677-5p	CLIP-seq
MIRT1076046	hsa-miR-3688-3p	CLIP-seq
MIRT1076047	hsa-miR-3692	CLIP-seq
MIRT1076048	hsa-miR-379	CLIP-seq
MIRT1076049	hsa-miR-3944-5p	CLIP-seq
MIRT1076050	hsa-miR-3976	CLIP-seq
MIRT1076051	hsa-miR-421	CLIP-seq
MIRT1076052	hsa-miR-4261	CLIP-seq
MIRT1076053	hsa-miR-4276	CLIP-seq
MIRT1076054	hsa-miR-4310	CLIP-seq
MIRT1076055	hsa-miR-4311	CLIP-seq
MIRT1076056	hsa-miR-4314	CLIP-seq
MIRT1076057	hsa-miR-4422	CLIP-seq
MIRT1076058	hsa-miR-4437	CLIP-seq
MIRT1076059	hsa-miR-4451	CLIP-seq
MIRT1076060	hsa-miR-4453	CLIP-seq
MIRT1076061	hsa-miR-4457	CLIP-seq
MIRT1076062	hsa-miR-4464	CLIP-seq
MIRT1076063	hsa-miR-448	CLIP-seq
MIRT1076064	hsa-miR-4491	CLIP-seq
MIRT1076065	hsa-miR-4511	CLIP-seq
MIRT1076066	hsa-miR-4520a-3p	CLIP-seq
MIRT1076067	hsa-miR-4520b-3p	CLIP-seq
MIRT1076068	hsa-miR-4529-3p	CLIP-seq
MIRT1076069	hsa-miR-4536	CLIP-seq
MIRT1076070	hsa-miR-4538	CLIP-seq
MIRT1076071	hsa-miR-4646-5p	CLIP-seq
MIRT1076072	hsa-miR-4650-3p	CLIP-seq
MIRT1076073	hsa-miR-4657	CLIP-seq
MIRT1076074	hsa-miR-4674	CLIP-seq
MIRT1076075	hsa-miR-4676-5p	CLIP-seq
MIRT1076076	hsa-miR-4701-5p	CLIP-seq
MIRT1076077	hsa-miR-4709-5p	CLIP-seq
MIRT1076078	hsa-miR-4748	CLIP-seq
MIRT1076079	hsa-miR-4758-3p	CLIP-seq
MIRT1076080	hsa-miR-4773	CLIP-seq
MIRT1076081	hsa-miR-4796-3p	CLIP-seq
MIRT1076082	hsa-miR-495	CLIP-seq
MIRT1076083	hsa-miR-512-3p	CLIP-seq
MIRT1076084	hsa-miR-514	CLIP-seq
MIRT1076085	hsa-miR-514b-3p	CLIP-seq
MIRT1076086	hsa-miR-519a	CLIP-seq
MIRT1076087	hsa-miR-519b-3p	CLIP-seq
MIRT1076088	hsa-miR-519c-3p	CLIP-seq
MIRT1076089	hsa-miR-519d	CLIP-seq
MIRT1076090	hsa-miR-520f	CLIP-seq
MIRT1076091	hsa-miR-520g	CLIP-seq
MIRT1076092	hsa-miR-520h	CLIP-seq
MIRT1076093	hsa-miR-522	CLIP-seq
MIRT1076094	hsa-miR-548a-5p	CLIP-seq
MIRT1076095	hsa-miR-548aa	CLIP-seq
MIRT1076096	hsa-miR-548ab	CLIP-seq
MIRT1076097	hsa-miR-548ak	CLIP-seq
MIRT1076098	hsa-miR-548b-3p	CLIP-seq
MIRT1076099	hsa-miR-548b-5p	CLIP-seq
MIRT1076100	hsa-miR-548c-5p	CLIP-seq
MIRT1076101	hsa-miR-548d-5p	CLIP-seq
MIRT1076102	hsa-miR-548h	CLIP-seq
MIRT1076103	hsa-miR-548i	CLIP-seq
MIRT1076104	hsa-miR-548j	CLIP-seq
MIRT1076105	hsa-miR-548n	CLIP-seq
MIRT1076106	hsa-miR-548o	CLIP-seq
MIRT1076107	hsa-miR-548w	CLIP-seq
MIRT1076108	hsa-miR-548y	CLIP-seq
MIRT1076109	hsa-miR-552	CLIP-seq
MIRT1076110	hsa-miR-559	CLIP-seq
MIRT1076111	hsa-miR-568	CLIP-seq
MIRT1076112	hsa-miR-575	CLIP-seq
MIRT1076113	hsa-miR-583	CLIP-seq
MIRT1076114	hsa-miR-588	CLIP-seq
MIRT1076115	hsa-miR-642b	CLIP-seq
MIRT1076116	hsa-miR-765	CLIP-seq
MIRT1076117	hsa-miR-769-5p	CLIP-seq
MIRT1076118	hsa-miR-802	CLIP-seq
MIRT1076119	hsa-miR-876-3p	CLIP-seq
MIRT1076120	hsa-miR-93	CLIP-seq
MIRT2018893	hsa-miR-103a	CLIP-seq
MIRT1076007	hsa-miR-106a	CLIP-seq
MIRT1076008	hsa-miR-106b	CLIP-seq
MIRT1076011	hsa-miR-125a-3p	CLIP-seq
MIRT2018894	hsa-miR-1263	CLIP-seq
MIRT2018895	hsa-miR-1264	CLIP-seq
MIRT1076012	hsa-miR-1276	CLIP-seq
MIRT2018896	hsa-miR-139-5p	CLIP-seq
MIRT1076015	hsa-miR-142-5p	CLIP-seq
MIRT1076020	hsa-miR-1587	CLIP-seq
MIRT1076021	hsa-miR-17	CLIP-seq
MIRT1076025	hsa-miR-20a	CLIP-seq
MIRT1076026	hsa-miR-20b	CLIP-seq
MIRT2018897	hsa-miR-214	CLIP-seq
MIRT1076027	hsa-miR-299-3p	CLIP-seq
MIRT2018898	hsa-miR-302a	CLIP-seq
MIRT2018899	hsa-miR-302b	CLIP-seq
MIRT2018900	hsa-miR-302c	CLIP-seq
MIRT2018901	hsa-miR-302d	CLIP-seq
MIRT2018902	hsa-miR-302e	CLIP-seq
MIRT1076028	hsa-miR-30a	CLIP-seq
MIRT1076029	hsa-miR-30b	CLIP-seq
MIRT1076030	hsa-miR-30c	CLIP-seq
MIRT1076031	hsa-miR-30d	CLIP-seq
MIRT1076032	hsa-miR-30e	CLIP-seq
MIRT1076033	hsa-miR-3120-3p	CLIP-seq
MIRT1076034	hsa-miR-3124-3p	CLIP-seq
MIRT2018903	hsa-miR-3140-5p	CLIP-seq
MIRT2018904	hsa-miR-3143	CLIP-seq
MIRT1076036	hsa-miR-3149	CLIP-seq
MIRT2018905	hsa-miR-3160-5p	CLIP-seq
MIRT2018906	hsa-miR-3168	CLIP-seq
MIRT2018907	hsa-miR-3171	CLIP-seq
MIRT1076038	hsa-miR-3173-3p	CLIP-seq
MIRT2018908	hsa-miR-323b-5p	CLIP-seq
MIRT1076042	hsa-miR-338-5p	CLIP-seq
MIRT1076043	hsa-miR-340	CLIP-seq
MIRT2018909	hsa-miR-3619-5p	CLIP-seq
MIRT2018910	hsa-miR-3668	CLIP-seq
MIRT2018911	hsa-miR-3671	CLIP-seq
MIRT2018912	hsa-miR-3674	CLIP-seq
MIRT1076045	hsa-miR-3677-5p	CLIP-seq
MIRT1076046	hsa-miR-3688-3p	CLIP-seq
MIRT1076047	hsa-miR-3692	CLIP-seq
MIRT2018913	hsa-miR-372	CLIP-seq
MIRT2018914	hsa-miR-373	CLIP-seq
MIRT2018915	hsa-miR-3935	CLIP-seq
MIRT2018916	hsa-miR-3941	CLIP-seq
MIRT2018917	hsa-miR-3942-3p	CLIP-seq
MIRT1076050	hsa-miR-3976	CLIP-seq
MIRT1076051	hsa-miR-421	CLIP-seq
MIRT2018918	hsa-miR-4252	CLIP-seq
MIRT1076052	hsa-miR-4261	CLIP-seq
MIRT2018919	hsa-miR-4302	CLIP-seq
MIRT1076055	hsa-miR-4311	CLIP-seq
MIRT1076058	hsa-miR-4437	CLIP-seq
MIRT2018920	hsa-miR-4438	CLIP-seq
MIRT1076061	hsa-miR-4457	CLIP-seq
MIRT1076062	hsa-miR-4464	CLIP-seq
MIRT2018921	hsa-miR-4477a	CLIP-seq
MIRT1076063	hsa-miR-448	CLIP-seq
MIRT1076064	hsa-miR-4491	CLIP-seq
MIRT2018922	hsa-miR-4503	CLIP-seq
MIRT2018923	hsa-miR-4528	CLIP-seq
MIRT1076069	hsa-miR-4536	CLIP-seq
MIRT2018924	hsa-miR-4643	CLIP-seq
MIRT1076073	hsa-miR-4657	CLIP-seq
MIRT2018925	hsa-miR-466	CLIP-seq
MIRT2018926	hsa-miR-4668-5p	CLIP-seq
MIRT2018927	hsa-miR-4672	CLIP-seq
MIRT1076074	hsa-miR-4674	CLIP-seq
MIRT2018928	hsa-miR-4680-3p	CLIP-seq
MIRT1076076	hsa-miR-4701-5p	CLIP-seq
MIRT1076077	hsa-miR-4709-5p	CLIP-seq
MIRT2018929	hsa-miR-4720-3p	CLIP-seq
MIRT2018930	hsa-miR-4724-5p	CLIP-seq
MIRT1076078	hsa-miR-4748	CLIP-seq
MIRT2018931	hsa-miR-4774-5p	CLIP-seq
MIRT2018932	hsa-miR-4789-3p	CLIP-seq
MIRT2018933	hsa-miR-4804-3p	CLIP-seq
MIRT1076084	hsa-miR-514	CLIP-seq
MIRT1076085	hsa-miR-514b-3p	CLIP-seq
MIRT1076086	hsa-miR-519a	CLIP-seq
MIRT1076087	hsa-miR-519b-3p	CLIP-seq
MIRT1076088	hsa-miR-519c-3p	CLIP-seq
MIRT1076089	hsa-miR-519d	CLIP-seq
MIRT2018934	hsa-miR-520a-3p	CLIP-seq
MIRT2018935	hsa-miR-520b	CLIP-seq
MIRT2018936	hsa-miR-520c-3p	CLIP-seq
MIRT2018937	hsa-miR-520d-3p	CLIP-seq
MIRT2018938	hsa-miR-520e	CLIP-seq
MIRT1076090	hsa-miR-520f	CLIP-seq
MIRT1076091	hsa-miR-520g	CLIP-seq
MIRT1076092	hsa-miR-520h	CLIP-seq
MIRT1076093	hsa-miR-522	CLIP-seq
MIRT2018939	hsa-miR-526b	CLIP-seq
MIRT2018940	hsa-miR-545	CLIP-seq
MIRT1076109	hsa-miR-552	CLIP-seq
MIRT1076111	hsa-miR-568	CLIP-seq
MIRT2018941	hsa-miR-580	CLIP-seq
MIRT1076113	hsa-miR-583	CLIP-seq
MIRT1076114	hsa-miR-588	CLIP-seq
MIRT2018942	hsa-miR-607	CLIP-seq
MIRT2018943	hsa-miR-616	CLIP-seq
MIRT2018944	hsa-miR-619	CLIP-seq
MIRT1076115	hsa-miR-642b	CLIP-seq
MIRT2018945	hsa-miR-648	CLIP-seq
MIRT2018946	hsa-miR-656	CLIP-seq
MIRT2018947	hsa-miR-659	CLIP-seq
MIRT2018948	hsa-miR-761	CLIP-seq
MIRT1076116	hsa-miR-765	CLIP-seq
MIRT1076117	hsa-miR-769-5p	CLIP-seq
MIRT1076120	hsa-miR-93	CLIP-seq
MIRT2018893	hsa-miR-103a	CLIP-seq
MIRT1076009	hsa-miR-1179	CLIP-seq
MIRT2250763	hsa-miR-1207-3p	CLIP-seq
MIRT1076011	hsa-miR-125a-3p	CLIP-seq
MIRT1076012	hsa-miR-1276	CLIP-seq
MIRT1076014	hsa-miR-1323	CLIP-seq
MIRT1076015	hsa-miR-142-5p	CLIP-seq
MIRT1076016	hsa-miR-148a	CLIP-seq
MIRT1076017	hsa-miR-148b	CLIP-seq
MIRT1076018	hsa-miR-152	CLIP-seq
MIRT1076019	hsa-miR-153	CLIP-seq
MIRT1076020	hsa-miR-1587	CLIP-seq
MIRT2018897	hsa-miR-214	CLIP-seq
MIRT1076027	hsa-miR-299-3p	CLIP-seq
MIRT1076028	hsa-miR-30a	CLIP-seq
MIRT1076029	hsa-miR-30b	CLIP-seq
MIRT1076030	hsa-miR-30c	CLIP-seq
MIRT1076031	hsa-miR-30d	CLIP-seq
MIRT1076032	hsa-miR-30e	CLIP-seq
MIRT1076033	hsa-miR-3120-3p	CLIP-seq
MIRT2250764	hsa-miR-3123	CLIP-seq
MIRT2018903	hsa-miR-3140-5p	CLIP-seq
MIRT2018904	hsa-miR-3143	CLIP-seq
MIRT1076036	hsa-miR-3149	CLIP-seq
MIRT2018906	hsa-miR-3168	CLIP-seq
MIRT2018907	hsa-miR-3171	CLIP-seq
MIRT1076042	hsa-miR-338-5p	CLIP-seq
MIRT1076043	hsa-miR-340	CLIP-seq
MIRT2018909	hsa-miR-3619-5p	CLIP-seq
MIRT2250765	hsa-miR-3681	CLIP-seq
MIRT1076046	hsa-miR-3688-3p	CLIP-seq
MIRT2018917	hsa-miR-3942-3p	CLIP-seq
MIRT1076049	hsa-miR-3944-5p	CLIP-seq
MIRT1076051	hsa-miR-421	CLIP-seq
MIRT1076052	hsa-miR-4261	CLIP-seq
MIRT2250766	hsa-miR-4299	CLIP-seq
MIRT1076054	hsa-miR-4310	CLIP-seq
MIRT1076055	hsa-miR-4311	CLIP-seq
MIRT1076058	hsa-miR-4437	CLIP-seq
MIRT2018920	hsa-miR-4438	CLIP-seq
MIRT2250767	hsa-miR-4463	CLIP-seq
MIRT1076063	hsa-miR-448	CLIP-seq
MIRT1076064	hsa-miR-4491	CLIP-seq
MIRT2250768	hsa-miR-4494	CLIP-seq
MIRT1076065	hsa-miR-4511	CLIP-seq
MIRT1076069	hsa-miR-4536	CLIP-seq
MIRT1076073	hsa-miR-4657	CLIP-seq
MIRT2018926	hsa-miR-4668-5p	CLIP-seq
MIRT1076074	hsa-miR-4674	CLIP-seq
MIRT2018928	hsa-miR-4680-3p	CLIP-seq
MIRT1076077	hsa-miR-4709-5p	CLIP-seq
MIRT2250769	hsa-miR-4710	CLIP-seq
MIRT2018930	hsa-miR-4724-5p	CLIP-seq
MIRT1076080	hsa-miR-4773	CLIP-seq
MIRT2250770	hsa-miR-4792	CLIP-seq
MIRT2250771	hsa-miR-499a-5p	CLIP-seq
MIRT1076091	hsa-miR-520g	CLIP-seq
MIRT1076092	hsa-miR-520h	CLIP-seq
MIRT2018939	hsa-miR-526b	CLIP-seq
MIRT2018940	hsa-miR-545	CLIP-seq
MIRT2250772	hsa-miR-548a-3p	CLIP-seq
MIRT1076094	hsa-miR-548a-5p	CLIP-seq
MIRT1076095	hsa-miR-548aa	CLIP-seq
MIRT1076096	hsa-miR-548ab	CLIP-seq
MIRT1076097	hsa-miR-548ak	CLIP-seq
MIRT1076098	hsa-miR-548b-3p	CLIP-seq
MIRT1076099	hsa-miR-548b-5p	CLIP-seq
MIRT1076100	hsa-miR-548c-5p	CLIP-seq
MIRT1076101	hsa-miR-548d-5p	CLIP-seq
MIRT2250773	hsa-miR-548e	CLIP-seq
MIRT2250774	hsa-miR-548f	CLIP-seq
MIRT2250775	hsa-miR-548g	CLIP-seq
MIRT1076102	hsa-miR-548h	CLIP-seq
MIRT1076103	hsa-miR-548i	CLIP-seq
MIRT1076104	hsa-miR-548j	CLIP-seq
MIRT1076105	hsa-miR-548n	CLIP-seq
MIRT1076106	hsa-miR-548o	CLIP-seq
MIRT1076107	hsa-miR-548w	CLIP-seq
MIRT1076108	hsa-miR-548y	CLIP-seq
MIRT1076109	hsa-miR-552	CLIP-seq
MIRT1076110	hsa-miR-559	CLIP-seq
MIRT1076111	hsa-miR-568	CLIP-seq
MIRT2250776	hsa-miR-570	CLIP-seq
MIRT2018941	hsa-miR-580	CLIP-seq
MIRT1076113	hsa-miR-583	CLIP-seq
MIRT2018946	hsa-miR-656	CLIP-seq
MIRT2018948	hsa-miR-761	CLIP-seq
MIRT1076117	hsa-miR-769-5p	CLIP-seq
MIRT1076118	hsa-miR-802	CLIP-seq
MIRT2250777	hsa-miR-885-3p	CLIP-seq
MIRT2018903	hsa-miR-3140-5p	CLIP-seq
MIRT2018906	hsa-miR-3168	CLIP-seq
MIRT2018907	hsa-miR-3171	CLIP-seq
MIRT2018917	hsa-miR-3942-3p	CLIP-seq
MIRT2018918	hsa-miR-4252	CLIP-seq
MIRT2018920	hsa-miR-4438	CLIP-seq
MIRT2018928	hsa-miR-4680-3p	CLIP-seq
MIRT2018930	hsa-miR-4724-5p	CLIP-seq
MIRT2018939	hsa-miR-526b	CLIP-seq
MIRT2018941	hsa-miR-580	CLIP-seq
MIRT1076115	hsa-miR-642b	CLIP-seq
MIRT1076117	hsa-miR-769-5p	CLIP-seq
MIRT1076012	hsa-miR-1276	CLIP-seq
MIRT2018896	hsa-miR-139-5p	CLIP-seq
MIRT2430178	hsa-miR-3125	CLIP-seq
MIRT1076042	hsa-miR-338-5p	CLIP-seq
MIRT2430179	hsa-miR-3916	CLIP-seq
MIRT2018916	hsa-miR-3941	CLIP-seq
MIRT2018919	hsa-miR-4302	CLIP-seq
MIRT1076055	hsa-miR-4311	CLIP-seq
MIRT2018921	hsa-miR-4477a	CLIP-seq
MIRT2018922	hsa-miR-4503	CLIP-seq
MIRT2018924	hsa-miR-4643	CLIP-seq
MIRT2018925	hsa-miR-466	CLIP-seq
MIRT2430180	hsa-miR-4666-5p	CLIP-seq
MIRT2018927	hsa-miR-4672	CLIP-seq
MIRT2018931	hsa-miR-4774-5p	CLIP-seq
MIRT2018932	hsa-miR-4789-3p	CLIP-seq
MIRT2430181	hsa-miR-4789-5p	CLIP-seq
MIRT2430182	hsa-miR-550a	CLIP-seq
MIRT1076113	hsa-miR-583	CLIP-seq
MIRT2018944	hsa-miR-619	CLIP-seq
MIRT2018945	hsa-miR-648	CLIP-seq
MIRT1076020	hsa-miR-1587	CLIP-seq
MIRT2018903	hsa-miR-3140-5p	CLIP-seq
MIRT2018907	hsa-miR-3171	CLIP-seq
MIRT2018918	hsa-miR-4252	CLIP-seq
MIRT1076058	hsa-miR-4437	CLIP-seq
MIRT1076074	hsa-miR-4674	CLIP-seq
MIRT2018928	hsa-miR-4680-3p	CLIP-seq
MIRT2018930	hsa-miR-4724-5p	CLIP-seq
MIRT1076115	hsa-miR-642b	CLIP-seq
MIRT1076117	hsa-miR-769-5p	CLIP-seq
MIRT2554216	hsa-miR-1202	CLIP-seq
MIRT2554217	hsa-miR-1227	CLIP-seq
MIRT2554218	hsa-miR-1251	CLIP-seq
MIRT1076011	hsa-miR-125a-3p	CLIP-seq
MIRT2018894	hsa-miR-1263	CLIP-seq
MIRT1076012	hsa-miR-1276	CLIP-seq
MIRT2554219	hsa-miR-1297	CLIP-seq
MIRT2554220	hsa-miR-1304	CLIP-seq
MIRT2018896	hsa-miR-139-5p	CLIP-seq
MIRT2554221	hsa-miR-140-3p	CLIP-seq
MIRT1076020	hsa-miR-1587	CLIP-seq
MIRT2554222	hsa-miR-193a-5p	CLIP-seq
MIRT2554223	hsa-miR-23a	CLIP-seq
MIRT2554224	hsa-miR-23b	CLIP-seq
MIRT2554225	hsa-miR-23c	CLIP-seq
MIRT2554226	hsa-miR-26a	CLIP-seq
MIRT2554227	hsa-miR-26b	CLIP-seq
MIRT1076034	hsa-miR-3124-3p	CLIP-seq
MIRT2430178	hsa-miR-3125	CLIP-seq
MIRT2018903	hsa-miR-3140-5p	CLIP-seq
MIRT1076037	hsa-miR-3164	CLIP-seq
MIRT2018907	hsa-miR-3171	CLIP-seq
MIRT1076038	hsa-miR-3173-3p	CLIP-seq
MIRT2554228	hsa-miR-3194-5p	CLIP-seq
MIRT1076042	hsa-miR-338-5p	CLIP-seq
MIRT2554229	hsa-miR-3616-3p	CLIP-seq
MIRT2554230	hsa-miR-3653	CLIP-seq
MIRT2554231	hsa-miR-3658	CLIP-seq
MIRT2018912	hsa-miR-3674	CLIP-seq
MIRT2250765	hsa-miR-3681	CLIP-seq
MIRT2554232	hsa-miR-3682-3p	CLIP-seq
MIRT1076046	hsa-miR-3688-3p	CLIP-seq
MIRT1076047	hsa-miR-3692	CLIP-seq
MIRT2554233	hsa-miR-371-3p	CLIP-seq
MIRT2554234	hsa-miR-371b-3p	CLIP-seq
MIRT2430179	hsa-miR-3916	CLIP-seq
MIRT2018915	hsa-miR-3935	CLIP-seq
MIRT2018916	hsa-miR-3941	CLIP-seq
MIRT2018917	hsa-miR-3942-3p	CLIP-seq
MIRT2554235	hsa-miR-3972	CLIP-seq
MIRT1076051	hsa-miR-421	CLIP-seq
MIRT2018918	hsa-miR-4252	CLIP-seq
MIRT1076052	hsa-miR-4261	CLIP-seq
MIRT1076053	hsa-miR-4276	CLIP-seq
MIRT2018919	hsa-miR-4302	CLIP-seq
MIRT1076055	hsa-miR-4311	CLIP-seq
MIRT2554236	hsa-miR-4317	CLIP-seq
MIRT1076058	hsa-miR-4437	CLIP-seq
MIRT1076061	hsa-miR-4457	CLIP-seq
MIRT2554237	hsa-miR-4465	CLIP-seq
MIRT2018921	hsa-miR-4477a	CLIP-seq
MIRT2250768	hsa-miR-4494	CLIP-seq
MIRT2018922	hsa-miR-4503	CLIP-seq
MIRT1076065	hsa-miR-4511	CLIP-seq
MIRT1076066	hsa-miR-4520a-3p	CLIP-seq
MIRT1076067	hsa-miR-4520b-3p	CLIP-seq
MIRT1076068	hsa-miR-4529-3p	CLIP-seq
MIRT2554238	hsa-miR-455-5p	CLIP-seq
MIRT2018924	hsa-miR-4643	CLIP-seq
MIRT2018925	hsa-miR-466	CLIP-seq
MIRT2430180	hsa-miR-4666-5p	CLIP-seq
MIRT2018927	hsa-miR-4672	CLIP-seq
MIRT1076074	hsa-miR-4674	CLIP-seq
MIRT2018928	hsa-miR-4680-3p	CLIP-seq
MIRT2554239	hsa-miR-4684-3p	CLIP-seq
MIRT2554240	hsa-miR-4694-3p	CLIP-seq
MIRT1076077	hsa-miR-4709-5p	CLIP-seq
MIRT2554241	hsa-miR-4721	CLIP-seq
MIRT2018930	hsa-miR-4724-5p	CLIP-seq
MIRT1076080	hsa-miR-4773	CLIP-seq
MIRT2018931	hsa-miR-4774-5p	CLIP-seq
MIRT2018932	hsa-miR-4789-3p	CLIP-seq
MIRT2430181	hsa-miR-4789-5p	CLIP-seq
MIRT1076082	hsa-miR-495	CLIP-seq
MIRT2554242	hsa-miR-498	CLIP-seq
MIRT2250771	hsa-miR-499a-5p	CLIP-seq
MIRT2554243	hsa-miR-515-3p	CLIP-seq
MIRT2554244	hsa-miR-519e	CLIP-seq
MIRT1076093	hsa-miR-522	CLIP-seq
MIRT2250772	hsa-miR-548a-3p	CLIP-seq
MIRT1076094	hsa-miR-548a-5p	CLIP-seq
MIRT1076096	hsa-miR-548ab	CLIP-seq
MIRT2554245	hsa-miR-548ac	CLIP-seq
MIRT2554246	hsa-miR-548ae	CLIP-seq
MIRT2554247	hsa-miR-548aj	CLIP-seq
MIRT1076097	hsa-miR-548ak	CLIP-seq
MIRT2554248	hsa-miR-548am	CLIP-seq
MIRT1076098	hsa-miR-548b-3p	CLIP-seq
MIRT1076099	hsa-miR-548b-5p	CLIP-seq
MIRT1076100	hsa-miR-548c-5p	CLIP-seq
MIRT2554249	hsa-miR-548d-3p	CLIP-seq
MIRT1076101	hsa-miR-548d-5p	CLIP-seq
MIRT2250773	hsa-miR-548e	CLIP-seq
MIRT2250774	hsa-miR-548f	CLIP-seq
MIRT2250775	hsa-miR-548g	CLIP-seq
MIRT1076102	hsa-miR-548h	CLIP-seq
MIRT1076103	hsa-miR-548i	CLIP-seq
MIRT1076104	hsa-miR-548j	CLIP-seq
MIRT1076105	hsa-miR-548n	CLIP-seq
MIRT2554250	hsa-miR-548u	CLIP-seq
MIRT1076107	hsa-miR-548w	CLIP-seq
MIRT2554251	hsa-miR-548x	CLIP-seq
MIRT1076108	hsa-miR-548y	CLIP-seq
MIRT2554252	hsa-miR-548z	CLIP-seq
MIRT2430182	hsa-miR-550a	CLIP-seq
MIRT1076109	hsa-miR-552	CLIP-seq
MIRT1076110	hsa-miR-559	CLIP-seq
MIRT2250776	hsa-miR-570	CLIP-seq
MIRT1076113	hsa-miR-583	CLIP-seq
MIRT1076115	hsa-miR-642b	CLIP-seq
MIRT2018945	hsa-miR-648	CLIP-seq
MIRT1076116	hsa-miR-765	CLIP-seq
MIRT2554253	hsa-miR-767-5p	CLIP-seq
MIRT1076117	hsa-miR-769-5p	CLIP-seq
MIRT1076118	hsa-miR-802	CLIP-seq
MIRT2554254	hsa-miR-891b	CLIP-seq
MIRT2554218	hsa-miR-1251	CLIP-seq
MIRT1076011	hsa-miR-125a-3p	CLIP-seq
MIRT2018894	hsa-miR-1263	CLIP-seq
MIRT1076012	hsa-miR-1276	CLIP-seq
MIRT2554219	hsa-miR-1297	CLIP-seq
MIRT2018896	hsa-miR-139-5p	CLIP-seq
MIRT2554221	hsa-miR-140-3p	CLIP-seq
MIRT1076020	hsa-miR-1587	CLIP-seq
MIRT2554222	hsa-miR-193a-5p	CLIP-seq
MIRT2554223	hsa-miR-23a	CLIP-seq
MIRT2554224	hsa-miR-23b	CLIP-seq
MIRT2554225	hsa-miR-23c	CLIP-seq
MIRT2554226	hsa-miR-26a	CLIP-seq
MIRT2554227	hsa-miR-26b	CLIP-seq
MIRT1076034	hsa-miR-3124-3p	CLIP-seq
MIRT2430178	hsa-miR-3125	CLIP-seq
MIRT2018903	hsa-miR-3140-5p	CLIP-seq
MIRT1076037	hsa-miR-3164	CLIP-seq
MIRT2018907	hsa-miR-3171	CLIP-seq
MIRT1076038	hsa-miR-3173-3p	CLIP-seq
MIRT1076042	hsa-miR-338-5p	CLIP-seq
MIRT2018912	hsa-miR-3674	CLIP-seq
MIRT2250765	hsa-miR-3681	CLIP-seq
MIRT2554232	hsa-miR-3682-3p	CLIP-seq
MIRT1076046	hsa-miR-3688-3p	CLIP-seq
MIRT1076047	hsa-miR-3692	CLIP-seq
MIRT2554233	hsa-miR-371-3p	CLIP-seq
MIRT2554234	hsa-miR-371b-3p	CLIP-seq
MIRT2430179	hsa-miR-3916	CLIP-seq
MIRT2018915	hsa-miR-3935	CLIP-seq
MIRT2018916	hsa-miR-3941	CLIP-seq
MIRT2018917	hsa-miR-3942-3p	CLIP-seq
MIRT1076051	hsa-miR-421	CLIP-seq
MIRT2018918	hsa-miR-4252	CLIP-seq
MIRT1076052	hsa-miR-4261	CLIP-seq
MIRT1076053	hsa-miR-4276	CLIP-seq
MIRT2018919	hsa-miR-4302	CLIP-seq
MIRT1076055	hsa-miR-4311	CLIP-seq
MIRT2554236	hsa-miR-4317	CLIP-seq
MIRT1076058	hsa-miR-4437	CLIP-seq
MIRT1076061	hsa-miR-4457	CLIP-seq
MIRT2554237	hsa-miR-4465	CLIP-seq
MIRT2018921	hsa-miR-4477a	CLIP-seq
MIRT2250768	hsa-miR-4494	CLIP-seq
MIRT2018922	hsa-miR-4503	CLIP-seq
MIRT1076066	hsa-miR-4520a-3p	CLIP-seq
MIRT1076067	hsa-miR-4520b-3p	CLIP-seq
MIRT1076068	hsa-miR-4529-3p	CLIP-seq
MIRT2018924	hsa-miR-4643	CLIP-seq
MIRT2018925	hsa-miR-466	CLIP-seq
MIRT2430180	hsa-miR-4666-5p	CLIP-seq
MIRT2018927	hsa-miR-4672	CLIP-seq
MIRT1076074	hsa-miR-4674	CLIP-seq
MIRT2018928	hsa-miR-4680-3p	CLIP-seq
MIRT2554239	hsa-miR-4684-3p	CLIP-seq
MIRT2554240	hsa-miR-4694-3p	CLIP-seq
MIRT1076077	hsa-miR-4709-5p	CLIP-seq
MIRT2018930	hsa-miR-4724-5p	CLIP-seq
MIRT2018932	hsa-miR-4789-3p	CLIP-seq
MIRT2430181	hsa-miR-4789-5p	CLIP-seq
MIRT1076082	hsa-miR-495	CLIP-seq
MIRT2554242	hsa-miR-498	CLIP-seq
MIRT2250771	hsa-miR-499a-5p	CLIP-seq
MIRT2554243	hsa-miR-515-3p	CLIP-seq
MIRT2554244	hsa-miR-519e	CLIP-seq
MIRT1076093	hsa-miR-522	CLIP-seq
MIRT2250772	hsa-miR-548a-3p	CLIP-seq
MIRT1076094	hsa-miR-548a-5p	CLIP-seq
MIRT1076096	hsa-miR-548ab	CLIP-seq
MIRT2554245	hsa-miR-548ac	CLIP-seq
MIRT2554246	hsa-miR-548ae	CLIP-seq
MIRT2554247	hsa-miR-548aj	CLIP-seq
MIRT1076097	hsa-miR-548ak	CLIP-seq
MIRT2554248	hsa-miR-548am	CLIP-seq
MIRT1076099	hsa-miR-548b-5p	CLIP-seq
MIRT1076100	hsa-miR-548c-5p	CLIP-seq
MIRT2554249	hsa-miR-548d-3p	CLIP-seq
MIRT1076101	hsa-miR-548d-5p	CLIP-seq
MIRT2250773	hsa-miR-548e	CLIP-seq
MIRT2250774	hsa-miR-548f	CLIP-seq
MIRT2250775	hsa-miR-548g	CLIP-seq
MIRT1076102	hsa-miR-548h	CLIP-seq
MIRT1076103	hsa-miR-548i	CLIP-seq
MIRT1076104	hsa-miR-548j	CLIP-seq
MIRT1076105	hsa-miR-548n	CLIP-seq
MIRT2554250	hsa-miR-548u	CLIP-seq
MIRT1076107	hsa-miR-548w	CLIP-seq
MIRT2554251	hsa-miR-548x	CLIP-seq
MIRT1076108	hsa-miR-548y	CLIP-seq
MIRT2554252	hsa-miR-548z	CLIP-seq
MIRT2430182	hsa-miR-550a	CLIP-seq
MIRT1076109	hsa-miR-552	CLIP-seq
MIRT1076110	hsa-miR-559	CLIP-seq
MIRT2250776	hsa-miR-570	CLIP-seq
MIRT1076113	hsa-miR-583	CLIP-seq
MIRT1076115	hsa-miR-642b	CLIP-seq
MIRT2018945	hsa-miR-648	CLIP-seq
MIRT1076116	hsa-miR-765	CLIP-seq
MIRT2554253	hsa-miR-767-5p	CLIP-seq
MIRT1076117	hsa-miR-769-5p	CLIP-seq
MIRT1076118	hsa-miR-802	CLIP-seq
MIRT2554254	hsa-miR-891b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Unknown	11163768

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1386289, 9446616, 10825200, 31892268
GO:0004713	Function	Protein tyrosine kinase activity	IC	7543512
GO:0004713	Function	Protein tyrosine kinase activity	IDA	7532278, 7929391, 7973659, 8272873, 8756628, 10702271, 15226449
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	1848670
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	7657660, 8232552
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	8232552, 34813358
GO:0005131	Function	Growth hormone receptor binding	IBA
GO:0005131	Function	Growth hormone receptor binding	IEA
GO:0005131	Function	Growth hormone receptor binding	ISS	10502458
GO:0005515	Function	Protein binding	IPI	7759950, 16273093, 16710296, 21220115, 21679692, 25065853, 26175413, 28514442, 32953130, 33961781, 34950606, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10502458
GO:0005737	Component	Cytoplasm	IC	7532278
GO:0005737	Component	Cytoplasm	IDA	10502458
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IC	10702271
GO:0005886	Component	Plasma membrane	TAS	34813358
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9020188, 28753426
GO:0006468	Process	Protein phosphorylation	IMP	28111307, 32750333
GO:0006468	Process	Protein phosphorylation	TAS	1848670
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	7526154, 7657660, 7759950, 8272873, 8605876, 23139419, 28753426
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	7657660, 8232552, 8272873
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IMP	28111307, 32750333
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	12574355
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	8232552
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	8272873
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019903	Function	Protein phosphatase binding	IPI	11909529
GO:0022407	Process	Regulation of cell-cell adhesion	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IDA	28781374
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IC	7543512, 7929391, 7973659, 8272873, 8756628
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	7973659
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24882218
GO:0031730	Function	CCR5 chemokine receptor binding	IEA
GO:0034112	Process	Positive regulation of homotypic cell-cell adhesion	IMP	21679692
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	8232552
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IDA	7760829
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IDA	7929391
GO:0035771	Process	Interleukin-4-mediated signaling pathway	NAS	12574355
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7568005
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7973659, 11909529
GO:0038110	Process	Interleukin-2-mediated signaling pathway	TAS
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IC	20974963
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	29202461
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	9535918
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	8756628
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IDA	28781374
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IDA	8272872
GO:0038196	Process	Type III interferon-mediated signaling pathway	NAS	30936491
GO:0043235	Component	Receptor complex	IPI	21854986
GO:0046677	Process	Response to antibiotic	IDA	16280321
GO:0046872	Function	Metal ion binding	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	IDA	8232552
GO:0060333	Process	Type II interferon-mediated signaling pathway	NAS	15864272
GO:0060333	Process	Type II interferon-mediated signaling pathway	TAS
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	7532278, 8232552
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	23391734
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0060337	Process	Type I interferon-mediated signaling pathway	TAS
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873
GO:0070102	Process	Interleukin-6-mediated signaling pathway	TAS
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0098586	Process	Cellular response to virus	NAS	15864272, 30936491
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512
GO:0150105	Process	Protein localization to cell-cell junction	IMP	21679692
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	8605876, 26479788
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26479788
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IGI	20299512

Other IDs

• MIM: 147795
• HGNC: 6190
• e!Ensembl: ENSG00000162434

Protein

• UniProt ID: P23458
• Protein name: Tyrosine-protein kinase JAK1 (EC 2.7.10.2) (Janus kinase 1) (JAK-1)
• Protein function: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway (PubMed:16239216, PubMed:28111307, PubMed:32750333, PubMed:7615558, PubMed:8232552). Kinase partner for the interleukin (IL)-2 receptor (PubMed:1190952
• PDB: 3EYG, 3EYH, 4E4L, 4E4N, 4E5W, 4EHZ, 4EI4, 4FK6, 4GS0, 4I5C, 4IVB, 4IVC, 4IVD, 4K6Z, 4K77, 4L00, 4L01, 5E1E, 5HX8, 5IXD, 5IXI, 5KHW, 5KHX, 5L04, 5WO4, 6AAH, 6BBU, 6C7Y, 6DBN, 6ELR, 6GGH, 6HZU, 6N77, 6N78, 6N79, 6N7A, 6N7B, 6N7C, 6N7D, 6RSB, 6RSC, 6RSD, 6RSE, 6RSH, 6SM8, 6SMB, 6TPE, 6TPF, 6W8L, 8EXJ, 8S85
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18379	FERM_F1	36 → 129	FERM F1 ubiquitin-like domain	Domain
  PF18377	FERM_F2	147 → 277	FERM F2 acyl-CoA binding protein-like domain	Domain
  PF17887	Jak1_Phl	284 → 421	Jak1 pleckstrin homology-like domain	Domain
  PF07714	PK_Tyr_Ser-Thr	583 → 845	Protein tyrosine and serine/threonine kinase	Domain
  PF07714	PK_Tyr_Ser-Thr	875 → 1149	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue. {ECO:0000269|PubMed:7896447}.
• Sequence:

  MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
  CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
  DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
  DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
  NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
  WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
  EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
  HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
  CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
  KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
  TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
  VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
  LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
  TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
  IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
  TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
  SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
  DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
  DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
  SFQNLIEGFEALLK

• Sequence length: 1154

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
PI3K-Akt signaling pathway
Necroptosis
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Leishmaniasis
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer

Reactome:

Interleukin-6 signaling
MAPK3 (ERK1) activation
MAPK1 (ERK2) activation
ISG15 antiviral mechanism
Interleukin-7 signaling
Other interleukin signaling
RAF/MAP kinase cascade
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
IL-6-type cytokine receptor ligand interactions
Interferon gamma signaling
Regulation of IFNG signaling
Interleukin-20 family signaling
Interleukin-15 signaling
Interleukin-35 Signalling
Interleukin-9 signaling
Interleukin-2 signaling
Interleukin-12 signaling
Interleukin-27 signaling
Interleukin-21 signaling
Interferon alpha/beta signaling
Interleukin receptor SHC signaling
Regulation of IFNA signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute megakaryoblastic leukemia in down syndrome	Likely pathogenic	rs1655079234	RCV001293764	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoinflammation, immune dysregulation, and eosinophilia	Pathogenic; Likely pathogenic	rs2524099521, rs869312953, rs1655173102	RCV002280062 RCV001255134 RCV001255135	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive mendelian susceptibility to mycobacterial diseases due to partial jak1 deficiency	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST IMPLANT-ASSOCIATED ANAPLASTIC LARGE CELL LYMPHOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory myofibroblastic tumor	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JAK1-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	27086927		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	18559588, 20868368		★☆☆☆☆ Found in Text Mining only
Acute lymphoblastic leukemia with lymphomatous features	Lymphoblastic Leukemia With Lymphomatous Features	CLINVAR_DG	19139102, 19470474, 19838194, 20167706, 21680795, 22955920		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18362173, 19139102, 20167706, 20697856, 21436584, 23340138, 25942645, 26443624, 28245838, 28410228		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28619982		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	21436577, 21436584		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28989534, 29121062		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26840709, 28879441, 31407334		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	30115734		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25762644		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18362173, 23340138, 25942645, 26443624, 28245838		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27799566, 28031410		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26811457		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	20697856		★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	37171742	Associate	★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	27007833		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	31031313		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	31031313		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	21245760, 27785927, 27789678, 28188131		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	27789678	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	35590143	Associate	★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	28241173		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29530480, 30360970		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28677798		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	26586478	Associate	★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	37343845	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	29530480	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30562763		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	29530480	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23968543, 25398374, 31181818, 33950229, 34521259, 38272919, 39724808	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	30360969, 31624837		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21827323, 30463918		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40604958	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	20052595	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	21551237, 27602765	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28334721	Associate	★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16239216, 23611997, 24737344, 29298069, 30113844, 30633369		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16239216		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	16239216, 34745118, 34845259	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21861134, 29695516, 29907599		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23674219, 24428981, 25410656, 26005883		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	25410656	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	37713898	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31552026		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28708884		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25104439, 27622335, 28240233, 30463015, 31790361		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25104439, 29436642, 31790361, 34572592, 35441810, 35575798, 37779428	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	7929242		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33323549, 36376931	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22930530, 23788652, 29628508, 29805309, 31560893, 31852247, 32705212, 35504805, 35710093	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31552026		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21216930, 21861134, 29736209		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17573897, 26911335, 36775874	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25319391		★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	28241173	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32960689	Associate	★☆☆☆☆ Found in Text Mining only
Chilblain lupus 1	Chilblain Lupus Erythematosus	BEFREE	27892610		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18362173, 19470474, 23340138, 25942645, 26443624, 28245838, 28410228		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	24321752		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26158860		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19295546, 20130243, 22875628, 24766055, 26443624, 29042365, 29645296, 29907599, 30203226, 30571852, 31286322, 31725895		★☆☆☆☆ Found in Text Mining only
Chronic Neutrophilic Leukemia	Neutrophilic Leukemia	BEFREE	26637732		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27003425		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22121102, 30655751		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30655751		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	8530527	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22121102, 24931611, 27546461, 28539123, 30670049		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18320073		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18320073, 27546461, 27903500, 28539123, 29641532, 30670049, 31783811, 35343934, 38001065, 39456850	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30657646		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28158411, 29051788, 29556726, 30088677, 30930775, 31327403		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27111231		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	27711196	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37343845	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22226123, 30357932, 31577341, 31629805, 31786154		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23808542		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23808542		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34589546	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28292965		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26783077, 28580640, 29516520		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32096183	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	19017763, 27333885, 28554737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	GWASCAT_DG	26305897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	37343845	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27799566, 28031410, 29295936		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27472900	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28316372	Inhibit	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22226123, 30357932, 31577341, 31629805, 31786154		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24154688, 27213585, 30816518		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24154688, 27213585, 29121062, 30816518, 35262923, 35849120	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36376931	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15299092		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	34496019, 37343845, 38563187	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19120899		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19120899		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23483572		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	15883164, 15894543, 24089705		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28154170, 30464391		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	24487795		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	37343845	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32629176	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28039266		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	32096183	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28445193, 28484267, 30453910, 31282592, 31821750		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	19887489, 23406773		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	36669486	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	28704535	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12032322, 33331925	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	26811457, 29907599		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	29650799	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	GENOMICS_ENGLAND_DG	28111307		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	38563187	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	20052595	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	16920889	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	29459227, 29693186	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	37343845	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28008925, 30671064		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19535621		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34042156, 36437465	Associate	★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	22355695, 27798858		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	16474838		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20167706, 21436584, 26208852, 31028744		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23733339, 34324169, 36418348	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18270328, 27903959, 34324169	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Acute, X-Linked	Leukemia	CLINVAR_DG	19139102		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18160671, 28619982, 29991678		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CLINVAR_DG	21436584, 21680795		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28622463		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	22355695, 27798858		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19239328, 22930530, 23613111, 24379610, 26249360, 26701727, 27998770, 28560434, 29731916, 30654066		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31666386		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24238495		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24833526	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22859983, 34745118	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24737344, 27055521, 30043749, 30462559		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	34745118	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27350337		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31833567		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18281483, 20697856, 28196286		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	31655559	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25104439, 27622335, 28240233, 30463015, 31790361		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24154688, 27213585, 30816518		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19120899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24398427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19239328, 31560893, 31692012		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21216930, 21861134, 29736209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25319391		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30990343		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14749471, 16102578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27049718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31552026		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18559588, 19239328, 19887489, 21722956, 23333246, 23991929, 24030211, 24154688, 27213585, 27903500, 28008925, 28031410, 28892075, 29121062, 29260411, 29641532, 30837996, 31085700, 31305264		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22121102, 30655751		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12032322, 31790361		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	37171742	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	35159191	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12777975		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16741510, 27903500, 28561041	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19949352, 26027934, 28561041		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	29641532	Associate	★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	21637744		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	20052595		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24577942		★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	29140408		★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	25356970		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11986233	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23885837, 27833099, 30635766, 31423579		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14760959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	28892075	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplasia	Myelodysplasia	BEFREE	30097215		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30097215		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	23042420, 23307549, 23313046, 23406773, 23670175, 24458439, 24766055, 25189727, 25189729, 25193869, 25441108, 26659587, 27740634, 27785927, 27789678, 27882812, 28188131, 28260257, 28395559, 28441920, 28500170, 28602585, 28930494, 29189896, 29283448, 29480036, 29515114, 29616317, 29907599, 30010187, 30043249, 30097215, 30324817, 30675650, 30962501, 30997748, 31201513, 31711337, 31778911		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27793879		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	20130243, 22875628, 23885837, 26443624, 27677740, 28028027, 29024542, 29056075, 29277359, 29515770, 29907599, 30571852, 31286322, 31289316, 31719581		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	23733339	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30849642		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30849642, 36213586	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19239328, 19887489, 21861134, 23609016, 24154688, 24293293, 24626739, 25319391, 26027934, 26283183, 27213585, 28039266, 28539123, 28677798, 28989534, 29121062, 30655751, 30837996, 31692012, 31790361		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	27997540	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	38563187	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28622463		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	31313387		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30411754		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21861134, 22891040, 27350337, 28729401, 28989534, 31085700		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29737494	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33297736	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28708884		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30796717		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16815388	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25319391		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34626802, 35820543, 37151134, 38143770	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30990343		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24293293		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24293293, 26586478	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	26215634	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28496202		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30206929, 30278442		★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	35271300	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26825585		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	29121062		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	29121062		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	16239216, 27102499, 28193568, 28277287, 28500170, 29074595, 29134817, 30571852, 31711337		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	CLINVAR_DG	16239216		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16239216, 28674362, 38563187	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	CGI_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18362173		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19139102, 21436584, 28410228		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18559588, 21193420, 21551237, 21880637, 29854301		★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	31552026		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	23042420, 23307549, 23313046, 23406773, 23670175, 24458439, 24766055, 25189727, 25189729, 25193869, 25441108, 26659587, 27740634, 27785927, 27789678, 27882812, 28188131, 28260257, 28395559, 28441920, 28500170, 28602585, 28930494, 29189896, 29283448, 29480036, 29515114, 29616317, 29907599, 30010187, 30043249, 30097215, 30324817, 30571852, 30675650, 30962501, 30997748, 31201513, 31711337, 31749302, 31778911		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14749471, 16102578		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10514409, 10660600, 27366948, 29641532, 32592689, 34322995	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16102578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27366948		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	26785220, 27774581, 28949012, 29127481, 30113844, 30357932, 30460374		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27711196, 31972249	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28478401		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	27711196		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	27711196	Stimulate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22121102		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24006460, 25398374, 26152731, 27993828, 27993829, 28199814, 28622463, 28708884, 28762476, 28829236, 29452839, 29687421, 29688617, 29908669, 29908670, 30058112, 30088677, 30219772, 30394138, 30633369, 30663869, 30767864, 30777075, 30784354, 30891131, 31194885, 31287230, 31448433, 31581859, 31642025		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	27007833	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37471168	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	26415585	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	27440725		★☆☆☆☆ Found in Text Mining only
Specific Language Disorder	Specific language disorder	Pubtator	31940699	Inhibit	★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	27789678	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28236344	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30185657		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31348981		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27049718		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27049718, 29121062, 37511629	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27049718	Stimulate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30760472		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18362173		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	24825865		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	29074595		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	27789678	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30278442	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	32554601	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37897947, 38275291	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21289371, 27075627		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	37838086	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28158411, 28790099, 29051788, 29556726, 29672874, 30930775, 31005036		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28008925, 28770966, 31552026, 39986350	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	31552026		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	29530480, 37713206	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	23611997		★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	37171742	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	28823882, 29127481		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	28823882, 29127481		★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	7973658		★☆☆☆☆ Found in Text Mining only