Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3692
Gene name	Eukaryotic translation initiation factor 6
Gene symbol	EIF6
Synonyms (NCBI Gene)	CABEIF3AITGB4BPb(2)gcneIF-6p27(BBP)p27BBP
Chromosome	20
Chromosome location	20q11.22
Summary	Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The pro

218

Show/Hide all (218)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049555	hsa-miR-92a-3p	CLASH	23622248
MIRT042302	hsa-miR-484	CLASH	23622248
MIRT537793	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT537794	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT537792	hsa-miR-3616-5p	PAR-CLIP	22012620
MIRT537791	hsa-miR-573	PAR-CLIP	22012620
MIRT507451	hsa-miR-10a-3p	PAR-CLIP	23446348
MIRT507450	hsa-miR-5700	PAR-CLIP	23446348
MIRT507449	hsa-miR-520a-5p	PAR-CLIP	23446348
MIRT507448	hsa-miR-525-5p	PAR-CLIP	23446348
MIRT507447	hsa-miR-3180-5p	PAR-CLIP	23446348
MIRT450881	hsa-miR-488-3p	PAR-CLIP	22100165
MIRT450880	hsa-miR-3662	PAR-CLIP	22100165
MIRT450879	hsa-miR-548an	PAR-CLIP	22100165
MIRT450878	hsa-miR-1279	PAR-CLIP	22100165
MIRT450877	hsa-miR-5681a	PAR-CLIP	22100165
MIRT450876	hsa-miR-6730-5p	PAR-CLIP	22100165
MIRT450875	hsa-miR-1273e	PAR-CLIP	22100165
MIRT537793	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT537794	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT537792	hsa-miR-3616-5p	PAR-CLIP	22012620
MIRT537791	hsa-miR-573	PAR-CLIP	22012620
MIRT507451	hsa-miR-10a-3p	PAR-CLIP	23446348
MIRT507450	hsa-miR-5700	PAR-CLIP	23446348
MIRT507449	hsa-miR-520a-5p	PAR-CLIP	23446348
MIRT507448	hsa-miR-525-5p	PAR-CLIP	23446348
MIRT507447	hsa-miR-3180-5p	PAR-CLIP	23446348
MIRT450881	hsa-miR-488-3p	PAR-CLIP	22100165
MIRT450880	hsa-miR-3662	PAR-CLIP	22100165
MIRT450879	hsa-miR-548an	PAR-CLIP	22100165
MIRT450878	hsa-miR-1279	PAR-CLIP	22100165
MIRT450877	hsa-miR-5681a	PAR-CLIP	22100165
MIRT450876	hsa-miR-6730-5p	PAR-CLIP	22100165
MIRT450875	hsa-miR-1273e	PAR-CLIP	22100165
MIRT959612	hsa-miR-2861	CLIP-seq
MIRT959613	hsa-miR-3157-5p	CLIP-seq
MIRT959614	hsa-miR-342-5p	CLIP-seq
MIRT959615	hsa-miR-3918	CLIP-seq
MIRT959616	hsa-miR-4436a	CLIP-seq
MIRT959617	hsa-miR-4506	CLIP-seq
MIRT959618	hsa-miR-4512	CLIP-seq
MIRT959619	hsa-miR-4530	CLIP-seq
MIRT959620	hsa-miR-4651	CLIP-seq
MIRT959621	hsa-miR-4664-5p	CLIP-seq
MIRT959622	hsa-miR-4691-3p	CLIP-seq
MIRT959623	hsa-miR-4700-3p	CLIP-seq
MIRT959624	hsa-miR-4722-3p	CLIP-seq
MIRT959625	hsa-miR-4763-5p	CLIP-seq
MIRT959626	hsa-miR-608	CLIP-seq
MIRT959627	hsa-miR-922	CLIP-seq
MIRT959628	hsa-miR-129-5p	CLIP-seq
MIRT959629	hsa-miR-3148	CLIP-seq
MIRT959630	hsa-miR-450b-5p	CLIP-seq
MIRT959631	hsa-miR-4645-5p	CLIP-seq
MIRT959632	hsa-miR-4673	CLIP-seq
MIRT959633	hsa-miR-507	CLIP-seq
MIRT959634	hsa-miR-552	CLIP-seq
MIRT959635	hsa-miR-557	CLIP-seq
MIRT1920183	hsa-miR-1	CLIP-seq
MIRT1920184	hsa-miR-1202	CLIP-seq
MIRT1920185	hsa-miR-198	CLIP-seq
MIRT1920186	hsa-miR-206	CLIP-seq
MIRT1920187	hsa-miR-3187-3p	CLIP-seq
MIRT1920188	hsa-miR-3194-5p	CLIP-seq
MIRT1920189	hsa-miR-338-3p	CLIP-seq
MIRT1920190	hsa-miR-3972	CLIP-seq
MIRT1920191	hsa-miR-4434	CLIP-seq
MIRT1920192	hsa-miR-4435	CLIP-seq
MIRT1920193	hsa-miR-4491	CLIP-seq
MIRT1920194	hsa-miR-4516	CLIP-seq
MIRT1920195	hsa-miR-4531	CLIP-seq
MIRT1920196	hsa-miR-455-3p	CLIP-seq
MIRT1920197	hsa-miR-4657	CLIP-seq
MIRT1920198	hsa-miR-4701-5p	CLIP-seq
MIRT959624	hsa-miR-4722-3p	CLIP-seq
MIRT1920199	hsa-miR-548s	CLIP-seq
MIRT1920200	hsa-miR-588	CLIP-seq
MIRT1920201	hsa-miR-613	CLIP-seq
MIRT1920184	hsa-miR-1202	CLIP-seq
MIRT1984261	hsa-miR-2278	CLIP-seq
MIRT1920188	hsa-miR-3194-5p	CLIP-seq
MIRT1984262	hsa-miR-3202	CLIP-seq
MIRT1920190	hsa-miR-3972	CLIP-seq
MIRT1984263	hsa-miR-4533	CLIP-seq
MIRT1984264	hsa-miR-4641	CLIP-seq
MIRT1984265	hsa-miR-657	CLIP-seq
MIRT1984266	hsa-miR-890	CLIP-seq
MIRT1920184	hsa-miR-1202	CLIP-seq
MIRT2219362	hsa-miR-1262	CLIP-seq
MIRT959628	hsa-miR-129-5p	CLIP-seq
MIRT2219363	hsa-miR-1910	CLIP-seq
MIRT1920185	hsa-miR-198	CLIP-seq
MIRT1984261	hsa-miR-2278	CLIP-seq
MIRT959612	hsa-miR-2861	CLIP-seq
MIRT2219364	hsa-miR-296-3p	CLIP-seq
MIRT959629	hsa-miR-3148	CLIP-seq
MIRT959613	hsa-miR-3157-5p	CLIP-seq
MIRT1920187	hsa-miR-3187-3p	CLIP-seq
MIRT1920188	hsa-miR-3194-5p	CLIP-seq
MIRT1984262	hsa-miR-3202	CLIP-seq
MIRT1920189	hsa-miR-338-3p	CLIP-seq
MIRT2219365	hsa-miR-3670	CLIP-seq
MIRT959615	hsa-miR-3918	CLIP-seq
MIRT1920190	hsa-miR-3972	CLIP-seq
MIRT2219366	hsa-miR-4264	CLIP-seq
MIRT1920191	hsa-miR-4434	CLIP-seq
MIRT1920192	hsa-miR-4435	CLIP-seq
MIRT959616	hsa-miR-4436a	CLIP-seq
MIRT959630	hsa-miR-450b-5p	CLIP-seq
MIRT959618	hsa-miR-4512	CLIP-seq
MIRT1920194	hsa-miR-4516	CLIP-seq
MIRT959619	hsa-miR-4530	CLIP-seq
MIRT1920195	hsa-miR-4531	CLIP-seq
MIRT1984263	hsa-miR-4533	CLIP-seq
MIRT1920196	hsa-miR-455-3p	CLIP-seq
MIRT1984264	hsa-miR-4641	CLIP-seq
MIRT959631	hsa-miR-4645-5p	CLIP-seq
MIRT959632	hsa-miR-4673	CLIP-seq
MIRT959622	hsa-miR-4691-3p	CLIP-seq
MIRT959623	hsa-miR-4700-3p	CLIP-seq
MIRT2219367	hsa-miR-4701-3p	CLIP-seq
MIRT1920198	hsa-miR-4701-5p	CLIP-seq
MIRT2219368	hsa-miR-4715-3p	CLIP-seq
MIRT959624	hsa-miR-4722-3p	CLIP-seq
MIRT2219369	hsa-miR-4727-5p	CLIP-seq
MIRT959625	hsa-miR-4763-5p	CLIP-seq
MIRT2219370	hsa-miR-4769-3p	CLIP-seq
MIRT959633	hsa-miR-507	CLIP-seq
MIRT1920199	hsa-miR-548s	CLIP-seq
MIRT959634	hsa-miR-552	CLIP-seq
MIRT959635	hsa-miR-557	CLIP-seq
MIRT1920200	hsa-miR-588	CLIP-seq
MIRT1984265	hsa-miR-657	CLIP-seq
MIRT2219371	hsa-miR-665	CLIP-seq
MIRT1984266	hsa-miR-890	CLIP-seq
MIRT959627	hsa-miR-922	CLIP-seq
MIRT1920183	hsa-miR-1	CLIP-seq
MIRT1920184	hsa-miR-1202	CLIP-seq
MIRT959628	hsa-miR-129-5p	CLIP-seq
MIRT1920185	hsa-miR-198	CLIP-seq
MIRT1920186	hsa-miR-206	CLIP-seq
MIRT1984261	hsa-miR-2278	CLIP-seq
MIRT959612	hsa-miR-2861	CLIP-seq
MIRT959613	hsa-miR-3157-5p	CLIP-seq
MIRT1920187	hsa-miR-3187-3p	CLIP-seq
MIRT1920188	hsa-miR-3194-5p	CLIP-seq
MIRT1984262	hsa-miR-3202	CLIP-seq
MIRT1920189	hsa-miR-338-3p	CLIP-seq
MIRT959615	hsa-miR-3918	CLIP-seq
MIRT1920190	hsa-miR-3972	CLIP-seq
MIRT1920191	hsa-miR-4434	CLIP-seq
MIRT1920192	hsa-miR-4435	CLIP-seq
MIRT959616	hsa-miR-4436a	CLIP-seq
MIRT1920193	hsa-miR-4491	CLIP-seq
MIRT959630	hsa-miR-450b-5p	CLIP-seq
MIRT959618	hsa-miR-4512	CLIP-seq
MIRT1920194	hsa-miR-4516	CLIP-seq
MIRT959619	hsa-miR-4530	CLIP-seq
MIRT1920195	hsa-miR-4531	CLIP-seq
MIRT1984263	hsa-miR-4533	CLIP-seq
MIRT1920196	hsa-miR-455-3p	CLIP-seq
MIRT1984264	hsa-miR-4641	CLIP-seq
MIRT959631	hsa-miR-4645-5p	CLIP-seq
MIRT1920197	hsa-miR-4657	CLIP-seq
MIRT959632	hsa-miR-4673	CLIP-seq
MIRT959622	hsa-miR-4691-3p	CLIP-seq
MIRT959623	hsa-miR-4700-3p	CLIP-seq
MIRT1920198	hsa-miR-4701-5p	CLIP-seq
MIRT2219368	hsa-miR-4715-3p	CLIP-seq
MIRT959624	hsa-miR-4722-3p	CLIP-seq
MIRT959625	hsa-miR-4763-5p	CLIP-seq
MIRT959633	hsa-miR-507	CLIP-seq
MIRT1920199	hsa-miR-548s	CLIP-seq
MIRT959635	hsa-miR-557	CLIP-seq
MIRT1920200	hsa-miR-588	CLIP-seq
MIRT1920201	hsa-miR-613	CLIP-seq
MIRT1984265	hsa-miR-657	CLIP-seq
MIRT2219371	hsa-miR-665	CLIP-seq
MIRT1984266	hsa-miR-890	CLIP-seq
MIRT959627	hsa-miR-922	CLIP-seq
MIRT1920183	hsa-miR-1	CLIP-seq
MIRT1920184	hsa-miR-1202	CLIP-seq
MIRT1920185	hsa-miR-198	CLIP-seq
MIRT1920186	hsa-miR-206	CLIP-seq
MIRT1984261	hsa-miR-2278	CLIP-seq
MIRT959612	hsa-miR-2861	CLIP-seq
MIRT959613	hsa-miR-3157-5p	CLIP-seq
MIRT1920187	hsa-miR-3187-3p	CLIP-seq
MIRT1920188	hsa-miR-3194-5p	CLIP-seq
MIRT1984262	hsa-miR-3202	CLIP-seq
MIRT1920189	hsa-miR-338-3p	CLIP-seq
MIRT959615	hsa-miR-3918	CLIP-seq
MIRT1920190	hsa-miR-3972	CLIP-seq
MIRT1920191	hsa-miR-4434	CLIP-seq
MIRT1920192	hsa-miR-4435	CLIP-seq
MIRT959616	hsa-miR-4436a	CLIP-seq
MIRT1920193	hsa-miR-4491	CLIP-seq
MIRT959618	hsa-miR-4512	CLIP-seq
MIRT1920194	hsa-miR-4516	CLIP-seq
MIRT959619	hsa-miR-4530	CLIP-seq
MIRT1920195	hsa-miR-4531	CLIP-seq
MIRT1984263	hsa-miR-4533	CLIP-seq
MIRT1920196	hsa-miR-455-3p	CLIP-seq
MIRT1984264	hsa-miR-4641	CLIP-seq
MIRT1920197	hsa-miR-4657	CLIP-seq
MIRT959622	hsa-miR-4691-3p	CLIP-seq
MIRT959623	hsa-miR-4700-3p	CLIP-seq
MIRT1920198	hsa-miR-4701-5p	CLIP-seq
MIRT2219368	hsa-miR-4715-3p	CLIP-seq
MIRT959624	hsa-miR-4722-3p	CLIP-seq
MIRT959625	hsa-miR-4763-5p	CLIP-seq
MIRT1920199	hsa-miR-548s	CLIP-seq
MIRT1920200	hsa-miR-588	CLIP-seq
MIRT1920201	hsa-miR-613	CLIP-seq
MIRT1984265	hsa-miR-657	CLIP-seq
MIRT2219371	hsa-miR-665	CLIP-seq
MIRT1984266	hsa-miR-890	CLIP-seq
MIRT959627	hsa-miR-922	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000054	Process	Ribosomal subunit export from nucleus	IBA
GO:0000054	Process	Ribosomal subunit export from nucleus	IEA
GO:0000460	Process	Maturation of 5.8S rRNA	IBA
GO:0000470	Process	Maturation of LSU-rRNA	IBA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	17507929, 21665150, 21903422, 22365962, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12426392
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9374518
GO:0005638	Component	Lamin filament	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	12426392
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005882	Component	Intermediate filament	IEA
GO:0006110	Process	Regulation of glycolytic process	IEA
GO:0006110	Process	Regulation of glycolytic process	ISS
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032868	Process	Response to insulin	ISS
GO:0035195	Process	MiRNA-mediated post-transcriptional gene silencing	IMP	17507929
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IMP	17507929
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042256	Process	Cytosolic ribosome assembly	IEA
GO:0042256	Process	Cytosolic ribosome assembly	IMP	21536732
GO:0042273	Process	Ribosomal large subunit biogenesis	IEA
GO:0042304	Process	Regulation of fatty acid biosynthetic process	IEA
GO:0042304	Process	Regulation of fatty acid biosynthetic process	ISS
GO:0043022	Function	Ribosome binding	IDA	21536732
GO:0043022	Function	Ribosome binding	IEA
GO:0043023	Function	Ribosomal large subunit binding	IBA
GO:0043023	Function	Ribosomal large subunit binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045652	Process	Regulation of megakaryocyte differentiation	IEA
GO:0045652	Process	Regulation of megakaryocyte differentiation	ISS
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045727	Process	Positive regulation of translation	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1902626	Process	Assembly of large subunit precursor of preribosome	IBA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	ISS

MIM	HGNC	e!Ensembl
602912	6159	ENSG00000242372

P56537

Protein name

Eukaryotic translation initiation factor 6 (eIF-6) (B(2)GCN homolog) (B4 integrin interactor) (CAB) (p27(BBP))

Protein function

Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm (PubMed:10085284, PubMed:14654845, PubMed:21536732, PubMed:32669547). Behaves as a stimulatory tra

PDB

6LQM , 6LSR , 6LSS , 6LU8 , 7OW7 , 8A3D , 8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FKZ , 8FL0 , 8FL2 , 8FL3 , 8FL4 , 8FL6 , 8FL7 , 8FL9 , 8FLA , 8FLB , 8FLC , 8FLD , 8FLE , 8FLF , 8IDT , 8IDY , 8IE3 , 8INE , 8INF , 8INK , 8IPD , 8IPX , 8IPY , 8IR1 , 8IR3 , 8OHD , 8OJ0 , 8OJ8 , 8RL2 , 9GMO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01912	eIF-6	4 → 204	eIF-6 family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level). {ECO:0000269|PubMed:11290417}.

Sequence

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG
RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPD
LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSL
IDSLT

Sequence length

245

Interactions

View interactions

	KEGG
	Ribosome biogenesis in eukaryotes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Exstrophy-epispadias complex	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OMPHALOCELE EXSTROPHY IMPERFORATE ANUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHWACHMAN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHWACHMAN-DIAMOND SYNDROME	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (73)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	28931779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30077122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10676626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	30585299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	31586263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	31586263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	30585299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25151356	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	30077122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10676626, 15122657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12733146, 34016142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28074905, 30077122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26213845, 29581788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10676626, 29254159, 31196358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39940699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31817792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31817792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29581788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35794622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31586263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	31586263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	28501868, 29870976, 30589965, 31045597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28693127		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21536732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	30585299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28715695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28074905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26462016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31817792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31586263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28074905, 30077122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26213845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27550487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30403833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27333287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25252159, 27913676, 28693127, 29581788, 30026845, 30077122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25886394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	GWASCAT_DG	20585627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27913676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31728906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30585299	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10676626, 25252159, 28693127, 28743432, 30026845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31576390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	30585299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	30585299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30077122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25871514, 28743432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37579195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	40049422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26213845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18327211, 22348144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	28693127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27550487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27550487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	31728906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25957199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29254159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	21536732, 24406167, 25252159, 25991726, 28331068, 30585299, 30780079, 31151987		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Disorders	Sleep Disorders	BEFREE	28501868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30077122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27333287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20331625, 27333287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	30585299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30540564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30540564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30540564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34450253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	26213845		★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF6 (eukaryotic translation initiation factor 6)