ITGB1 (integrin subunit beta 1)

Gene

• Entrez ID: 3688
• Gene name: Integrin subunit beta 1
• Gene symbol: ITGB1
• Synonyms (NCBI Gene): CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB
• Chromosome: 10
• Chromosome location: 10p11.22
• Summary: Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of process

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1565818580	->T	Risk-factor	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004015	hsa-miR-183-5p	Immunoblot, Immunocytochemistry, Luciferase reporter assay, qRT-PCR	19940135
MIRT002731	hsa-miR-124-3p	Microarray	15685193
MIRT002731	hsa-miR-124-3p	Immunoblot, Immunohistochemistry, qRT-PCR, Western blot	21196113
MIRT002731	hsa-miR-124-3p	Immunoblot, Immunohistochemistry, qRT-PCR, Western blot	21196113
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	21112327
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002731	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT019882	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT002731	hsa-miR-124-3p	Microarray	15685193
MIRT002731	hsa-miR-124-3p	Microarray	18668037
MIRT024365	hsa-miR-215-5p	Microarray	19074876
MIRT024365	hsa-miR-215-5p	Microarray	19074876
MIRT024365	hsa-miR-215-5p	Microarray	19074876
MIRT024365	hsa-miR-215-5p	Microarray	19074876
MIRT004015	hsa-miR-183-5p	Reporter assay;Other	19940135
MIRT026513	hsa-miR-192-5p	Microarray	19074876
MIRT035520	hsa-miR-9-3p	Luciferase reporter assay	23530058
MIRT050264	hsa-miR-25-3p	CLASH	23622248
MIRT044978	hsa-miR-186-5p	CLASH	23622248
MIRT039178	hsa-miR-769-5p	CLASH	23622248
MIRT054591	hsa-miR-134-5p	Luciferase reporter assay, Microarray, qRT-PCR	24498348
MIRT054591	hsa-miR-134-5p	Luciferase reporter assay, Microarray, qRT-PCR	24498348
MIRT054592	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24498407
MIRT438919	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438919	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT567125	hsa-miR-548n	PAR-CLIP	20371350
MIRT567124	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT567123	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT567122	hsa-miR-3609	PAR-CLIP	20371350
MIRT567121	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT567120	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT567119	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT567118	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT567117	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT567116	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT567115	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT567114	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT567113	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT567112	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT567111	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT567110	hsa-miR-3910	PAR-CLIP	20371350
MIRT567109	hsa-miR-4521	PAR-CLIP	20371350
MIRT567108	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT567107	hsa-miR-4493	PAR-CLIP	20371350
MIRT567106	hsa-miR-6126	PAR-CLIP	20371350
MIRT567105	hsa-miR-4452	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT440422	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440422	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731308	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	26766915
MIRT731308	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	26766915
MIRT731308	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	26766915
MIRT731308	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	26766915
MIRT731594	hsa-miR-29a-3p	Luciferase reporter assay	26903137
MIRT731594	hsa-miR-29a-3p	Luciferase reporter assay	26903137
MIRT731308	hsa-miR-29c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24870620
MIRT731308	hsa-miR-29c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24870620
MIRT731594	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26903137
MIRT731594	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26903137
MIRT035520	hsa-miR-9-3p	Microarray, qRT-PCR	28418879
MIRT035520	hsa-miR-9-3p	Microarray, qRT-PCR	28418879
MIRT026513	hsa-miR-192-5p	Immunofluorescence, Luciferase reporter assay, Western blot	26506238
MIRT736083	hsa-miR-182-5p	qRT-PCR	31605468
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT567125	hsa-miR-548n	PAR-CLIP	20371350
MIRT567124	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT567123	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT567122	hsa-miR-3609	PAR-CLIP	20371350
MIRT567121	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT567120	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT567119	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT567118	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT567117	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT567116	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT567115	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT567114	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT567113	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT567112	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT567111	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT567110	hsa-miR-3910	PAR-CLIP	20371350
MIRT567109	hsa-miR-4521	PAR-CLIP	20371350
MIRT567108	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT567107	hsa-miR-4493	PAR-CLIP	20371350
MIRT567106	hsa-miR-6126	PAR-CLIP	20371350
MIRT567105	hsa-miR-4452	PAR-CLIP	20371350
MIRT562112	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT562111	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT562110	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT562109	hsa-miR-1910-5p	PAR-CLIP	20371350
MIRT562108	hsa-miR-4308	PAR-CLIP	20371350
MIRT562106	hsa-miR-4292	PAR-CLIP	20371350
MIRT562107	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT562105	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT562104	hsa-miR-8073	PAR-CLIP	20371350
MIRT562103	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT562102	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT562101	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT562100	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT562099	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT562097	hsa-miR-183-3p	PAR-CLIP	20371350
MIRT562098	hsa-miR-223-3p	Luciferase reporter assay	38040672
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT1073986	hsa-miR-124	CLIP-seq
MIRT1073987	hsa-miR-1286	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1073990	hsa-miR-183	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT1073994	hsa-miR-3177-3p	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT1073999	hsa-miR-33a	CLIP-seq
MIRT1074000	hsa-miR-33b	CLIP-seq
MIRT1074001	hsa-miR-3613-3p	CLIP-seq
MIRT1074002	hsa-miR-3662	CLIP-seq
MIRT1074003	hsa-miR-3667-3p	CLIP-seq
MIRT1074004	hsa-miR-374c	CLIP-seq
MIRT1074005	hsa-miR-3921	CLIP-seq
MIRT1074006	hsa-miR-4265	CLIP-seq
MIRT1074007	hsa-miR-4276	CLIP-seq
MIRT1074008	hsa-miR-4296	CLIP-seq
MIRT1074009	hsa-miR-4302	CLIP-seq
MIRT1074010	hsa-miR-4320	CLIP-seq
MIRT1074011	hsa-miR-4322	CLIP-seq
MIRT1074012	hsa-miR-4328	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074014	hsa-miR-4436a	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074016	hsa-miR-4501	CLIP-seq
MIRT1074017	hsa-miR-4648	CLIP-seq
MIRT1074018	hsa-miR-4653-5p	CLIP-seq
MIRT1074019	hsa-miR-4654	CLIP-seq
MIRT1074020	hsa-miR-4661-5p	CLIP-seq
MIRT1074021	hsa-miR-4690-5p	CLIP-seq
MIRT1074022	hsa-miR-4699-3p	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT1074024	hsa-miR-4769-5p	CLIP-seq
MIRT1074025	hsa-miR-506	CLIP-seq
MIRT1074026	hsa-miR-507	CLIP-seq
MIRT1074027	hsa-miR-544	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074029	hsa-miR-557	CLIP-seq
MIRT1074030	hsa-miR-618	CLIP-seq
MIRT1074031	hsa-miR-621	CLIP-seq
MIRT1074032	hsa-miR-655	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT1074033	hsa-miR-106a	CLIP-seq
MIRT1074034	hsa-miR-106b	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT1073986	hsa-miR-124	CLIP-seq
MIRT1073987	hsa-miR-1286	CLIP-seq
MIRT1074035	hsa-miR-134	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1074036	hsa-miR-17	CLIP-seq
MIRT1073990	hsa-miR-183	CLIP-seq
MIRT1074037	hsa-miR-20a	CLIP-seq
MIRT1074038	hsa-miR-20b	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT1074039	hsa-miR-297	CLIP-seq
MIRT1074040	hsa-miR-302f	CLIP-seq
MIRT1074041	hsa-miR-3118	CLIP-seq
MIRT1074042	hsa-miR-3121-3p	CLIP-seq
MIRT1074043	hsa-miR-3164	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT1073999	hsa-miR-33a	CLIP-seq
MIRT1074000	hsa-miR-33b	CLIP-seq
MIRT1074044	hsa-miR-3545-3p	CLIP-seq
MIRT1074045	hsa-miR-3545-5p	CLIP-seq
MIRT1074046	hsa-miR-3647-3p	CLIP-seq
MIRT1074002	hsa-miR-3662	CLIP-seq
MIRT1074003	hsa-miR-3667-3p	CLIP-seq
MIRT1074047	hsa-miR-380	CLIP-seq
MIRT1074005	hsa-miR-3921	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT1074049	hsa-miR-423-3p	CLIP-seq
MIRT1074007	hsa-miR-4276	CLIP-seq
MIRT1074050	hsa-miR-4291	CLIP-seq
MIRT1074009	hsa-miR-4302	CLIP-seq
MIRT1074010	hsa-miR-4320	CLIP-seq
MIRT1074051	hsa-miR-4426	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074014	hsa-miR-4436a	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074053	hsa-miR-4484	CLIP-seq
MIRT1074054	hsa-miR-4495	CLIP-seq
MIRT1074016	hsa-miR-4501	CLIP-seq
MIRT1074055	hsa-miR-4509	CLIP-seq
MIRT1074056	hsa-miR-4524	CLIP-seq
MIRT1074057	hsa-miR-4527	CLIP-seq
MIRT1074058	hsa-miR-4637	CLIP-seq
MIRT1074059	hsa-miR-4647	CLIP-seq
MIRT1074018	hsa-miR-4653-5p	CLIP-seq
MIRT1074020	hsa-miR-4661-5p	CLIP-seq
MIRT1074060	hsa-miR-4662b	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT1074021	hsa-miR-4690-5p	CLIP-seq
MIRT1074022	hsa-miR-4699-3p	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT1074062	hsa-miR-494	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT1074064	hsa-miR-500a	CLIP-seq
MIRT1074025	hsa-miR-506	CLIP-seq
MIRT1074065	hsa-miR-519d	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT1074068	hsa-miR-545	CLIP-seq
MIRT1074069	hsa-miR-548a-3p	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074072	hsa-miR-548ah	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074077	hsa-miR-548e	CLIP-seq
MIRT1074078	hsa-miR-548f	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT1074082	hsa-miR-548k	CLIP-seq
MIRT1074083	hsa-miR-548l	CLIP-seq
MIRT1074084	hsa-miR-548p	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT1074088	hsa-miR-567	CLIP-seq
MIRT1074030	hsa-miR-618	CLIP-seq
MIRT1074031	hsa-miR-621	CLIP-seq
MIRT1074089	hsa-miR-648	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT1074091	hsa-miR-93	CLIP-seq
MIRT1073987	hsa-miR-1286	CLIP-seq
MIRT1074010	hsa-miR-4320	CLIP-seq
MIRT1074014	hsa-miR-4436a	CLIP-seq
MIRT1074020	hsa-miR-4661-5p	CLIP-seq
MIRT1074021	hsa-miR-4690-5p	CLIP-seq
MIRT1074022	hsa-miR-4699-3p	CLIP-seq
MIRT1074064	hsa-miR-500a	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074031	hsa-miR-621	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT2018288	hsa-miR-1264	CLIP-seq
MIRT1073987	hsa-miR-1286	CLIP-seq
MIRT2018289	hsa-miR-1305	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1073990	hsa-miR-183	CLIP-seq
MIRT2018290	hsa-miR-190	CLIP-seq
MIRT2018291	hsa-miR-190b	CLIP-seq
MIRT2018292	hsa-miR-1910	CLIP-seq
MIRT2018293	hsa-miR-2114	CLIP-seq
MIRT2018294	hsa-miR-223	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT2018295	hsa-miR-3157-3p	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT2018296	hsa-miR-3942-3p	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT2018297	hsa-miR-4421	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074014	hsa-miR-4436a	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074058	hsa-miR-4637	CLIP-seq
MIRT1074020	hsa-miR-4661-5p	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT1074021	hsa-miR-4690-5p	CLIP-seq
MIRT1074022	hsa-miR-4699-3p	CLIP-seq
MIRT2018298	hsa-miR-4704-3p	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT2018299	hsa-miR-4742-5p	CLIP-seq
MIRT2018300	hsa-miR-4793-5p	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT1074064	hsa-miR-500a	CLIP-seq
MIRT2018301	hsa-miR-513c	CLIP-seq
MIRT2018302	hsa-miR-514b-5p	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT1074027	hsa-miR-544	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074072	hsa-miR-548ah	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT1074084	hsa-miR-548p	CLIP-seq
MIRT2018303	hsa-miR-548t	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT2018304	hsa-miR-607	CLIP-seq
MIRT1074031	hsa-miR-621	CLIP-seq
MIRT2018305	hsa-miR-874	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT2018306	hsa-miR-938	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT2250146	hsa-miR-105	CLIP-seq
MIRT1074033	hsa-miR-106a	CLIP-seq
MIRT1074034	hsa-miR-106b	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT1073986	hsa-miR-124	CLIP-seq
MIRT2250147	hsa-miR-1253	CLIP-seq
MIRT2018288	hsa-miR-1264	CLIP-seq
MIRT1073987	hsa-miR-1286	CLIP-seq
MIRT2018289	hsa-miR-1305	CLIP-seq
MIRT2250148	hsa-miR-1323	CLIP-seq
MIRT1074035	hsa-miR-134	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1074036	hsa-miR-17	CLIP-seq
MIRT1073990	hsa-miR-183	CLIP-seq
MIRT2018292	hsa-miR-1910	CLIP-seq
MIRT1074037	hsa-miR-20a	CLIP-seq
MIRT1074038	hsa-miR-20b	CLIP-seq
MIRT2018293	hsa-miR-2114	CLIP-seq
MIRT2018294	hsa-miR-223	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT2250149	hsa-miR-29a	CLIP-seq
MIRT2250150	hsa-miR-29b	CLIP-seq
MIRT2250151	hsa-miR-29c	CLIP-seq
MIRT1074040	hsa-miR-302f	CLIP-seq
MIRT2250152	hsa-miR-30a	CLIP-seq
MIRT2250153	hsa-miR-30b	CLIP-seq
MIRT2250154	hsa-miR-30c	CLIP-seq
MIRT2250155	hsa-miR-30d	CLIP-seq
MIRT2250156	hsa-miR-30e	CLIP-seq
MIRT1074041	hsa-miR-3118	CLIP-seq
MIRT1074042	hsa-miR-3121-3p	CLIP-seq
MIRT2018295	hsa-miR-3157-3p	CLIP-seq
MIRT1074043	hsa-miR-3164	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT2250157	hsa-miR-34c-3p	CLIP-seq
MIRT1074045	hsa-miR-3545-5p	CLIP-seq
MIRT1074046	hsa-miR-3647-3p	CLIP-seq
MIRT1074002	hsa-miR-3662	CLIP-seq
MIRT1074003	hsa-miR-3667-3p	CLIP-seq
MIRT1074004	hsa-miR-374c	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT1074049	hsa-miR-423-3p	CLIP-seq
MIRT1074050	hsa-miR-4291	CLIP-seq
MIRT1074010	hsa-miR-4320	CLIP-seq
MIRT1074012	hsa-miR-4328	CLIP-seq
MIRT2018297	hsa-miR-4421	CLIP-seq
MIRT1074051	hsa-miR-4426	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074014	hsa-miR-4436a	CLIP-seq
MIRT2250158	hsa-miR-4473	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074016	hsa-miR-4501	CLIP-seq
MIRT1074056	hsa-miR-4524	CLIP-seq
MIRT1074057	hsa-miR-4527	CLIP-seq
MIRT1074058	hsa-miR-4637	CLIP-seq
MIRT1074059	hsa-miR-4647	CLIP-seq
MIRT1074020	hsa-miR-4661-5p	CLIP-seq
MIRT1074060	hsa-miR-4662b	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT1074021	hsa-miR-4690-5p	CLIP-seq
MIRT1074022	hsa-miR-4699-3p	CLIP-seq
MIRT2018298	hsa-miR-4704-3p	CLIP-seq
MIRT2250159	hsa-miR-4710	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT2018299	hsa-miR-4742-5p	CLIP-seq
MIRT2250160	hsa-miR-4792	CLIP-seq
MIRT2018300	hsa-miR-4793-5p	CLIP-seq
MIRT1074062	hsa-miR-494	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT1074064	hsa-miR-500a	CLIP-seq
MIRT1074025	hsa-miR-506	CLIP-seq
MIRT2250161	hsa-miR-512-3p	CLIP-seq
MIRT2018301	hsa-miR-513c	CLIP-seq
MIRT2018302	hsa-miR-514b-5p	CLIP-seq
MIRT1074065	hsa-miR-519d	CLIP-seq
MIRT2250162	hsa-miR-520f	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT2250163	hsa-miR-522	CLIP-seq
MIRT2250164	hsa-miR-542-3p	CLIP-seq
MIRT1074027	hsa-miR-544	CLIP-seq
MIRT1074068	hsa-miR-545	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT2250165	hsa-miR-548aa	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074072	hsa-miR-548ah	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT2250166	hsa-miR-548c-3p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT2250167	hsa-miR-548o	CLIP-seq
MIRT1074084	hsa-miR-548p	CLIP-seq
MIRT2018303	hsa-miR-548t	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT2018304	hsa-miR-607	CLIP-seq
MIRT1074030	hsa-miR-618	CLIP-seq
MIRT1074031	hsa-miR-621	CLIP-seq
MIRT1074089	hsa-miR-648	CLIP-seq
MIRT1074032	hsa-miR-655	CLIP-seq
MIRT2018305	hsa-miR-874	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT1074091	hsa-miR-93	CLIP-seq
MIRT2018306	hsa-miR-938	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT2018288	hsa-miR-1264	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT2018297	hsa-miR-4421	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074058	hsa-miR-4637	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT2018300	hsa-miR-4793-5p	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT2018301	hsa-miR-513c	CLIP-seq
MIRT2018302	hsa-miR-514b-5p	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT2250146	hsa-miR-105	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT2430140	hsa-miR-1226	CLIP-seq
MIRT2250147	hsa-miR-1253	CLIP-seq
MIRT2018288	hsa-miR-1264	CLIP-seq
MIRT2430141	hsa-miR-1279	CLIP-seq
MIRT1073987	hsa-miR-1286	CLIP-seq
MIRT2018289	hsa-miR-1305	CLIP-seq
MIRT2250148	hsa-miR-1323	CLIP-seq
MIRT1074035	hsa-miR-134	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1073990	hsa-miR-183	CLIP-seq
MIRT2018292	hsa-miR-1910	CLIP-seq
MIRT2018293	hsa-miR-2114	CLIP-seq
MIRT2018294	hsa-miR-223	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT1074040	hsa-miR-302f	CLIP-seq
MIRT2250152	hsa-miR-30a	CLIP-seq
MIRT2250153	hsa-miR-30b	CLIP-seq
MIRT2250154	hsa-miR-30c	CLIP-seq
MIRT2250155	hsa-miR-30d	CLIP-seq
MIRT2250156	hsa-miR-30e	CLIP-seq
MIRT1074041	hsa-miR-3118	CLIP-seq
MIRT1074042	hsa-miR-3121-3p	CLIP-seq
MIRT2018295	hsa-miR-3157-3p	CLIP-seq
MIRT1074043	hsa-miR-3164	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT2430142	hsa-miR-323-3p	CLIP-seq
MIRT2430143	hsa-miR-323b-3p	CLIP-seq
MIRT1073999	hsa-miR-33a	CLIP-seq
MIRT1074000	hsa-miR-33b	CLIP-seq
MIRT2250157	hsa-miR-34c-3p	CLIP-seq
MIRT1074044	hsa-miR-3545-3p	CLIP-seq
MIRT1074045	hsa-miR-3545-5p	CLIP-seq
MIRT2430144	hsa-miR-3607-3p	CLIP-seq
MIRT1074046	hsa-miR-3647-3p	CLIP-seq
MIRT2430145	hsa-miR-3674	CLIP-seq
MIRT2430146	hsa-miR-3688-3p	CLIP-seq
MIRT1074004	hsa-miR-374c	CLIP-seq
MIRT2430147	hsa-miR-3935	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT1074049	hsa-miR-423-3p	CLIP-seq
MIRT1074007	hsa-miR-4276	CLIP-seq
MIRT1074009	hsa-miR-4302	CLIP-seq
MIRT1074012	hsa-miR-4328	CLIP-seq
MIRT2018297	hsa-miR-4421	CLIP-seq
MIRT1074051	hsa-miR-4426	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074014	hsa-miR-4436a	CLIP-seq
MIRT2430148	hsa-miR-4446-5p	CLIP-seq
MIRT2250158	hsa-miR-4473	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074056	hsa-miR-4524	CLIP-seq
MIRT1074057	hsa-miR-4527	CLIP-seq
MIRT1074058	hsa-miR-4637	CLIP-seq
MIRT1074059	hsa-miR-4647	CLIP-seq
MIRT1074020	hsa-miR-4661-5p	CLIP-seq
MIRT1074060	hsa-miR-4662b	CLIP-seq
MIRT2430149	hsa-miR-4680-3p	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT1074021	hsa-miR-4690-5p	CLIP-seq
MIRT2430150	hsa-miR-4698	CLIP-seq
MIRT1074022	hsa-miR-4699-3p	CLIP-seq
MIRT2250159	hsa-miR-4710	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT2018299	hsa-miR-4742-5p	CLIP-seq
MIRT2250160	hsa-miR-4792	CLIP-seq
MIRT2018300	hsa-miR-4793-5p	CLIP-seq
MIRT1074062	hsa-miR-494	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT1074064	hsa-miR-500a	CLIP-seq
MIRT2250161	hsa-miR-512-3p	CLIP-seq
MIRT2018301	hsa-miR-513c	CLIP-seq
MIRT2018302	hsa-miR-514b-5p	CLIP-seq
MIRT2430151	hsa-miR-518a-5p	CLIP-seq
MIRT2250162	hsa-miR-520f	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT2250163	hsa-miR-522	CLIP-seq
MIRT2430152	hsa-miR-527	CLIP-seq
MIRT1074069	hsa-miR-548a-3p	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT2250165	hsa-miR-548aa	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074072	hsa-miR-548ah	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT2250166	hsa-miR-548c-3p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074077	hsa-miR-548e	CLIP-seq
MIRT1074078	hsa-miR-548f	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT1074082	hsa-miR-548k	CLIP-seq
MIRT2250167	hsa-miR-548o	CLIP-seq
MIRT1074084	hsa-miR-548p	CLIP-seq
MIRT2018303	hsa-miR-548t	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT2018304	hsa-miR-607	CLIP-seq
MIRT1074031	hsa-miR-621	CLIP-seq
MIRT2430153	hsa-miR-634	CLIP-seq
MIRT1074032	hsa-miR-655	CLIP-seq
MIRT2430154	hsa-miR-665	CLIP-seq
MIRT2018305	hsa-miR-874	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT2018306	hsa-miR-938	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT2430140	hsa-miR-1226	CLIP-seq
MIRT2018288	hsa-miR-1264	CLIP-seq
MIRT1074035	hsa-miR-134	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT2018290	hsa-miR-190	CLIP-seq
MIRT2018291	hsa-miR-190b	CLIP-seq
MIRT2018292	hsa-miR-1910	CLIP-seq
MIRT2018293	hsa-miR-2114	CLIP-seq
MIRT2018294	hsa-miR-223	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT1074040	hsa-miR-302f	CLIP-seq
MIRT1074041	hsa-miR-3118	CLIP-seq
MIRT1074043	hsa-miR-3164	CLIP-seq
MIRT1073994	hsa-miR-3177-3p	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT1073999	hsa-miR-33a	CLIP-seq
MIRT1074000	hsa-miR-33b	CLIP-seq
MIRT2430146	hsa-miR-3688-3p	CLIP-seq
MIRT1074004	hsa-miR-374c	CLIP-seq
MIRT2018296	hsa-miR-3942-3p	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT1074006	hsa-miR-4265	CLIP-seq
MIRT1074007	hsa-miR-4276	CLIP-seq
MIRT1074008	hsa-miR-4296	CLIP-seq
MIRT1074009	hsa-miR-4302	CLIP-seq
MIRT1074011	hsa-miR-4322	CLIP-seq
MIRT1074012	hsa-miR-4328	CLIP-seq
MIRT2018297	hsa-miR-4421	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074017	hsa-miR-4648	CLIP-seq
MIRT1074019	hsa-miR-4654	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT2018299	hsa-miR-4742-5p	CLIP-seq
MIRT1074024	hsa-miR-4769-5p	CLIP-seq
MIRT2018300	hsa-miR-4793-5p	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT1074026	hsa-miR-507	CLIP-seq
MIRT2437977	hsa-miR-511	CLIP-seq
MIRT2018301	hsa-miR-513c	CLIP-seq
MIRT2018302	hsa-miR-514b-5p	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT2250166	hsa-miR-548c-3p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT1074084	hsa-miR-548p	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074029	hsa-miR-557	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT2430153	hsa-miR-634	CLIP-seq
MIRT1074032	hsa-miR-655	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT2250146	hsa-miR-105	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT1073986	hsa-miR-124	CLIP-seq
MIRT2250147	hsa-miR-1253	CLIP-seq
MIRT2018288	hsa-miR-1264	CLIP-seq
MIRT2430141	hsa-miR-1279	CLIP-seq
MIRT2018289	hsa-miR-1305	CLIP-seq
MIRT1074035	hsa-miR-134	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1073990	hsa-miR-183	CLIP-seq
MIRT2018292	hsa-miR-1910	CLIP-seq
MIRT2018293	hsa-miR-2114	CLIP-seq
MIRT2018294	hsa-miR-223	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT2250152	hsa-miR-30a	CLIP-seq
MIRT2250153	hsa-miR-30b	CLIP-seq
MIRT2250154	hsa-miR-30c	CLIP-seq
MIRT2250155	hsa-miR-30d	CLIP-seq
MIRT2250156	hsa-miR-30e	CLIP-seq
MIRT1074041	hsa-miR-3118	CLIP-seq
MIRT2018295	hsa-miR-3157-3p	CLIP-seq
MIRT1074043	hsa-miR-3164	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT2430142	hsa-miR-323-3p	CLIP-seq
MIRT2430143	hsa-miR-323b-3p	CLIP-seq
MIRT2250157	hsa-miR-34c-3p	CLIP-seq
MIRT1074045	hsa-miR-3545-5p	CLIP-seq
MIRT1074001	hsa-miR-3613-3p	CLIP-seq
MIRT1074004	hsa-miR-374c	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT2553700	hsa-miR-3974	CLIP-seq
MIRT1074012	hsa-miR-4328	CLIP-seq
MIRT2018297	hsa-miR-4421	CLIP-seq
MIRT1074051	hsa-miR-4426	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074016	hsa-miR-4501	CLIP-seq
MIRT1074057	hsa-miR-4527	CLIP-seq
MIRT1074058	hsa-miR-4637	CLIP-seq
MIRT1074059	hsa-miR-4647	CLIP-seq
MIRT1074060	hsa-miR-4662b	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT2430150	hsa-miR-4698	CLIP-seq
MIRT2250159	hsa-miR-4710	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT2018299	hsa-miR-4742-5p	CLIP-seq
MIRT2553701	hsa-miR-4789-5p	CLIP-seq
MIRT2250160	hsa-miR-4792	CLIP-seq
MIRT2018300	hsa-miR-4793-5p	CLIP-seq
MIRT1074062	hsa-miR-494	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT1074025	hsa-miR-506	CLIP-seq
MIRT2018301	hsa-miR-513c	CLIP-seq
MIRT2018302	hsa-miR-514b-5p	CLIP-seq
MIRT2430151	hsa-miR-518a-5p	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT2250163	hsa-miR-522	CLIP-seq
MIRT2430152	hsa-miR-527	CLIP-seq
MIRT1074069	hsa-miR-548a-3p	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT2250166	hsa-miR-548c-3p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074077	hsa-miR-548e	CLIP-seq
MIRT1074078	hsa-miR-548f	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT1074082	hsa-miR-548k	CLIP-seq
MIRT1074084	hsa-miR-548p	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT2018304	hsa-miR-607	CLIP-seq
MIRT1074032	hsa-miR-655	CLIP-seq
MIRT2430154	hsa-miR-665	CLIP-seq
MIRT2018305	hsa-miR-874	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT2018306	hsa-miR-938	CLIP-seq
MIRT1073984	hsa-miR-103b	CLIP-seq
MIRT2250146	hsa-miR-105	CLIP-seq
MIRT1073985	hsa-miR-1206	CLIP-seq
MIRT1073986	hsa-miR-124	CLIP-seq
MIRT2250147	hsa-miR-1253	CLIP-seq
MIRT2018288	hsa-miR-1264	CLIP-seq
MIRT2430141	hsa-miR-1279	CLIP-seq
MIRT2018289	hsa-miR-1305	CLIP-seq
MIRT1074035	hsa-miR-134	CLIP-seq
MIRT1073988	hsa-miR-144	CLIP-seq
MIRT1073989	hsa-miR-153	CLIP-seq
MIRT1073990	hsa-miR-183	CLIP-seq
MIRT2018292	hsa-miR-1910	CLIP-seq
MIRT2018293	hsa-miR-2114	CLIP-seq
MIRT2018294	hsa-miR-223	CLIP-seq
MIRT1073991	hsa-miR-23a	CLIP-seq
MIRT1073992	hsa-miR-23b	CLIP-seq
MIRT1073993	hsa-miR-23c	CLIP-seq
MIRT1074040	hsa-miR-302f	CLIP-seq
MIRT2250152	hsa-miR-30a	CLIP-seq
MIRT2250153	hsa-miR-30b	CLIP-seq
MIRT2250154	hsa-miR-30c	CLIP-seq
MIRT2250155	hsa-miR-30d	CLIP-seq
MIRT2250156	hsa-miR-30e	CLIP-seq
MIRT1074041	hsa-miR-3118	CLIP-seq
MIRT2018295	hsa-miR-3157-3p	CLIP-seq
MIRT1074043	hsa-miR-3164	CLIP-seq
MIRT1073994	hsa-miR-3177-3p	CLIP-seq
MIRT1073995	hsa-miR-320a	CLIP-seq
MIRT1073996	hsa-miR-320b	CLIP-seq
MIRT1073997	hsa-miR-320c	CLIP-seq
MIRT1073998	hsa-miR-320d	CLIP-seq
MIRT2430142	hsa-miR-323-3p	CLIP-seq
MIRT2430143	hsa-miR-323b-3p	CLIP-seq
MIRT1073999	hsa-miR-33a	CLIP-seq
MIRT1074000	hsa-miR-33b	CLIP-seq
MIRT2250157	hsa-miR-34c-3p	CLIP-seq
MIRT1074045	hsa-miR-3545-5p	CLIP-seq
MIRT1074001	hsa-miR-3613-3p	CLIP-seq
MIRT2430146	hsa-miR-3688-3p	CLIP-seq
MIRT1074004	hsa-miR-374c	CLIP-seq
MIRT1074048	hsa-miR-3973	CLIP-seq
MIRT2553700	hsa-miR-3974	CLIP-seq
MIRT1074006	hsa-miR-4265	CLIP-seq
MIRT1074007	hsa-miR-4276	CLIP-seq
MIRT1074008	hsa-miR-4296	CLIP-seq
MIRT1074009	hsa-miR-4302	CLIP-seq
MIRT1074011	hsa-miR-4322	CLIP-seq
MIRT1074012	hsa-miR-4328	CLIP-seq
MIRT2018297	hsa-miR-4421	CLIP-seq
MIRT1074051	hsa-miR-4426	CLIP-seq
MIRT1074013	hsa-miR-4429	CLIP-seq
MIRT1074052	hsa-miR-4432	CLIP-seq
MIRT1074015	hsa-miR-448	CLIP-seq
MIRT1074016	hsa-miR-4501	CLIP-seq
MIRT1074057	hsa-miR-4527	CLIP-seq
MIRT1074058	hsa-miR-4637	CLIP-seq
MIRT1074059	hsa-miR-4647	CLIP-seq
MIRT1074017	hsa-miR-4648	CLIP-seq
MIRT1074019	hsa-miR-4654	CLIP-seq
MIRT1074020	hsa-miR-4661-5p	CLIP-seq
MIRT1074060	hsa-miR-4662b	CLIP-seq
MIRT1074061	hsa-miR-4684-3p	CLIP-seq
MIRT2430150	hsa-miR-4698	CLIP-seq
MIRT2250159	hsa-miR-4710	CLIP-seq
MIRT1074023	hsa-miR-4717-3p	CLIP-seq
MIRT2018299	hsa-miR-4742-5p	CLIP-seq
MIRT1074024	hsa-miR-4769-5p	CLIP-seq
MIRT2553701	hsa-miR-4789-5p	CLIP-seq
MIRT2250160	hsa-miR-4792	CLIP-seq
MIRT2018300	hsa-miR-4793-5p	CLIP-seq
MIRT1074062	hsa-miR-494	CLIP-seq
MIRT1074063	hsa-miR-499-5p	CLIP-seq
MIRT1074064	hsa-miR-500a	CLIP-seq
MIRT1074025	hsa-miR-506	CLIP-seq
MIRT1074026	hsa-miR-507	CLIP-seq
MIRT2018301	hsa-miR-513c	CLIP-seq
MIRT2018302	hsa-miR-514b-5p	CLIP-seq
MIRT2430151	hsa-miR-518a-5p	CLIP-seq
MIRT1074066	hsa-miR-520g	CLIP-seq
MIRT1074067	hsa-miR-520h	CLIP-seq
MIRT2250163	hsa-miR-522	CLIP-seq
MIRT2430152	hsa-miR-527	CLIP-seq
MIRT1074069	hsa-miR-548a-3p	CLIP-seq
MIRT1074070	hsa-miR-548a-5p	CLIP-seq
MIRT1074071	hsa-miR-548ab	CLIP-seq
MIRT1074073	hsa-miR-548ak	CLIP-seq
MIRT1074028	hsa-miR-548an	CLIP-seq
MIRT1074074	hsa-miR-548b-5p	CLIP-seq
MIRT2250166	hsa-miR-548c-3p	CLIP-seq
MIRT1074075	hsa-miR-548c-5p	CLIP-seq
MIRT1074076	hsa-miR-548d-5p	CLIP-seq
MIRT1074077	hsa-miR-548e	CLIP-seq
MIRT1074078	hsa-miR-548f	CLIP-seq
MIRT1074079	hsa-miR-548h	CLIP-seq
MIRT1074080	hsa-miR-548i	CLIP-seq
MIRT1074081	hsa-miR-548j	CLIP-seq
MIRT1074082	hsa-miR-548k	CLIP-seq
MIRT1074084	hsa-miR-548p	CLIP-seq
MIRT1074085	hsa-miR-548w	CLIP-seq
MIRT1074086	hsa-miR-548y	CLIP-seq
MIRT1074029	hsa-miR-557	CLIP-seq
MIRT1074087	hsa-miR-559	CLIP-seq
MIRT2018304	hsa-miR-607	CLIP-seq
MIRT1074032	hsa-miR-655	CLIP-seq
MIRT2430154	hsa-miR-665	CLIP-seq
MIRT2018305	hsa-miR-874	CLIP-seq
MIRT1074090	hsa-miR-888	CLIP-seq
MIRT2018306	hsa-miR-938	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXF2	Repression	19562724
HOXD1	Unknown	21501586
HOXD3	Unknown	14610084
PAX6	Unknown	10954416
TWIST1	Activation	17487558
TWIST2	Activation	17487558

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	30992345
GO:0000287	Function	Magnesium ion binding	IDA	33962943
GO:0001525	Process	Angiogenesis	IDA	29763414
GO:0001525	Process	Angiogenesis	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	TAS	11919189
GO:0001968	Function	Fibronectin binding	IBA
GO:0001968	Function	Fibronectin binding	IDA	26763945
GO:0001968	Function	Fibronectin binding	IEA
GO:0001968	Function	Fibronectin binding	IPI	11792823
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	10455171
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0003779	Function	Actin binding	IDA	16803572
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	TAS	8020569
GO:0005509	Function	Calcium ion binding	IDA	33962943
GO:0005515	Function	Protein binding	IPI	1542691, 2649503, 9281591, 9360996, 9722563, 10397731, 10604475, 10676904, 11279249, 11807099, 12473654, 12500944, 12592401, 12695522, 12724312, 12796480, 12807887, 14681217, 14970227, 15289498, 15466886, 15703214, 16076904, 16099422, 16754661, 16754960, 16803572, 17158881, 17690686
GO:0005737	Component	Cytoplasm	IDA	16803572
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	12869515, 16803572, 21310825
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10455171
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	14970227
GO:0005925	Component	Focal adhesion	IDA	12417594, 17158881, 23023225, 29162887
GO:0005925	Component	Focal adhesion	IEA
GO:0006909	Process	Phagocytosis	ISS
GO:0006968	Process	Cellular defense response	TAS	10201960
GO:0007155	Process	Cell adhesion	IDA	19703720
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	TAS	10201960
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	1715889
GO:0007159	Process	Leukocyte cell-cell adhesion	NAS	30819933
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IMP	9679049, 18156211, 18308860, 24823363
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543, 22451694, 30819933
GO:0007161	Process	Calcium-independent cell-matrix adhesion	IGI	19651211
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	24036928
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	31331973
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24823363
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	9679049, 19693543, 22451694, 30819933
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0007520	Process	Myoblast fusion	ISS
GO:0008283	Process	Cell population proliferation	IEA
GO:0008305	Component	Integrin complex	IBA
GO:0008354	Process	Germ cell migration	IEA
GO:0008542	Process	Visual learning	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	19581412, 23382103, 23658023, 23981064
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	1715889, 17158881, 19234460, 19933311, 20563599, 21310825, 23023225, 23154389, 23620790, 24036928, 25063885
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0010710	Process	Regulation of collagen catabolic process	IDA	10455171
GO:0010763	Process	Positive regulation of fibroblast migration	IDA	26763945
GO:0014704	Component	Intercalated disc	IEA
GO:0014850	Process	Response to muscle activity	IEA
GO:0015026	Function	Coreceptor activity	IEA
GO:0015026	Function	Coreceptor activity	TAS	23125415
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	TAS	11919189
GO:0019901	Function	Protein kinase binding	IBA
GO:0019960	Function	C-X3-C chemokine binding	IBA
GO:0019960	Function	C-X3-C chemokine binding	IDA	23125415
GO:0021943	Process	Formation of radial glial scaffolds	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0023035	Process	CD40 signaling pathway	IDA	31331973
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	ISS
GO:0030032	Process	Lamellipodium assembly	ISS
GO:0030175	Component	Filopodium	IDA	16803572
GO:0030175	Component	Filopodium	IEA
GO:0030183	Process	B cell differentiation	IC	1715889
GO:0030198	Process	Extracellular matrix organization	NAS	19693543
GO:0030335	Process	Positive regulation of cell migration	ISS
GO:0031175	Process	Neuron projection development	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031589	Process	Cell-substrate adhesion	IMP	19933311, 19940135
GO:0031594	Component	Neuromuscular junction	IDA	9415431
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0032154	Component	Cleavage furrow	IEA
GO:0032587	Component	Ruffle membrane	IDA	14970227
GO:0032587	Component	Ruffle membrane	IEA
GO:0032587	Component	Ruffle membrane	NAS	10455171
GO:0033627	Process	Cell adhesion mediated by integrin	IBA
GO:0033627	Process	Cell adhesion mediated by integrin	IDA	12807887, 17158881
GO:0033627	Process	Cell adhesion mediated by integrin	IEA
GO:0033627	Process	Cell adhesion mediated by integrin	ISS
GO:0033631	Process	Cell-cell adhesion mediated by integrin	IEP	17704059
GO:0034113	Process	Heterotypic cell-cell adhesion	IEA
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0034665	Component	Integrin alpha1-beta1 complex	IDA	24823363
GO:0034665	Component	Integrin alpha1-beta1 complex	NAS	22451694
GO:0034666	Component	Integrin alpha2-beta1 complex	IDA	24823363
GO:0034666	Component	Integrin alpha2-beta1 complex	IPI	14681217
GO:0034667	Component	Integrin alpha3-beta1 complex	IDA	24220332, 25063885
GO:0034668	Component	Integrin alpha4-beta1 complex	IPI	1542691
GO:0034668	Component	Integrin alpha4-beta1 complex	TAS	8020569
GO:0034674	Component	Integrin alpha5-beta1 complex	IDA	31331973, 33102950
GO:0034674	Component	Integrin alpha5-beta1 complex	IPI	22451694
GO:0034675	Component	Integrin alpha6-beta1 complex	IPI	2649503
GO:0034677	Component	Integrin alpha7-beta1 complex	IEA
GO:0034678	Component	Integrin alpha8-beta1 complex	TAS	21335239
GO:0034679	Component	Integrin alpha9-beta1 complex	IEA
GO:0034679	Component	Integrin alpha9-beta1 complex	IPI	25748048
GO:0034679	Component	Integrin alpha9-beta1 complex	ISS
GO:0034680	Component	Integrin alpha10-beta1 complex	IDA	24823363
GO:0034680	Component	Integrin alpha10-beta1 complex	IPI	9685391
GO:0034681	Component	Integrin alpha11-beta1 complex	IDA	24823363
GO:0034682	Component	Integrin alphav-beta1 complex	IPI	25398877
GO:0035024	Process	Negative regulation of Rho protein signal transduction	IEA
GO:0035313	Process	Wound healing, spreading of epidermal cells	NAS	22451694
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0035748	Component	Myelin sheath abaxonal region	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042383	Component	Sarcolemma	IDA	9415431
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IGI	19364818
GO:0043149	Process	Stress fiber assembly	IMP	24036928
GO:0043197	Component	Dendritic spine	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043236	Function	Laminin binding	IBA
GO:0043236	Function	Laminin binding	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IMP	25911094
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	25336636
GO:0045121	Component	Membrane raft	IDA	14559243
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045214	Process	Sarcomere organization	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045445	Process	Myoblast differentiation	ISS
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045743	Process	Positive regulation of fibroblast growth factor receptor signaling pathway	IDA	24044949
GO:0045766	Process	Positive regulation of angiogenesis	IMP	24044949
GO:0045906	Process	Negative regulation of vasoconstriction	IMP	35802072
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	10455171
GO:0048333	Process	Mesodermal cell differentiation	IEA
GO:0048333	Process	Mesodermal cell differentiation	IEP	23154389
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20183869
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048626	Process	Myoblast fate specification	IEA
GO:0048675	Process	Axon extension	IEA
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0050793	Process	Regulation of developmental process	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IPI	12869515
GO:0050901	Process	Leukocyte tethering or rolling	IMP	18308860
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	24044949
GO:0051951	Process	Positive regulation of glutamate uptake involved in transmission of nerve impulse	IEA
GO:0051951	Process	Positive regulation of glutamate uptake involved in transmission of nerve impulse	ISS
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055037	Component	Recycling endosome	IEA
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	IEA
GO:0060912	Process	Cardiac cell fate specification	IEA
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0071711	Process	Basement membrane organization	IEA
GO:0090303	Process	Positive regulation of wound healing	IDA	26763945
GO:0097060	Component	Synaptic membrane	IEA
GO:0097386	Component	Glial cell projection	ISS
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098639	Function	Collagen binding involved in cell-matrix adhesion	IBA
GO:0098639	Function	Collagen binding involved in cell-matrix adhesion	IMP	24823363
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	IEA
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	ISS
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150003	Process	Regulation of spontaneous synaptic transmission	IEA
GO:0150003	Process	Regulation of spontaneous synaptic transmission	ISS
GO:0150053	Component	Cerebellar climbing fiber to Purkinje cell synapse	IEA
GO:0150103	Process	Reactive gliosis	IEA
GO:0150103	Process	Reactive gliosis	ISS
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IDA	24044949
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	10455171
GO:1905806	Process	Regulation of synapse pruning	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	26763945
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356

Other IDs

• MIM: 135630
• HGNC: 6153
• e!Ensembl: ENSG00000150093

Protein

• UniProt ID: P05556
• Protein name: Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)
• Protein function: Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G-E-R in collagen. Integrins alpha-2/beta-1,
• PDB: 3G9W, 3T9K, 3VI3, 3VI4, 4DX9, 4WJK, 4WK0, 4WK2, 4WK4, 7CEB, 7CEC, 7NWL, 7NXD, 8RPQ, 8W30, 9B9J, 9B9K, 9CKV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17205	PSI_integrin	25 → 76	Integrin plexin domain	Domain
  PF00362	Integrin_beta	138 → 382	Integrin beta chain VWA domain	Domain
  PF18372	I-EGF_1	466 → 495	Integrin beta epidermal growth factor like domain 1	Domain
  PF07974	EGF_2	599 → 630	EGF-like domain	Domain
  PF07965	Integrin_B_tail	640 → 728	Integrin beta tail domain	Domain
  PF08725	Integrin_b_cyt	752 → 796	Integrin beta cytoplasmic domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in vascular smooth muscle cells (at protein level). {ECO:0000269|PubMed:35802072}.; TISSUE SPECIFICITY: [Isoform 1]: Expressed in placenta (at protein level) (PubMed:33962943). Widely expressed, other isoforms are generally c
• Sequence:

  MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
  SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
  LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
  RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
  ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
  CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
  SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
  GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
  NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
  RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
  ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
  CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
  PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
  PIYKSAVTTVVNPKYEGK

• Sequence length: 798

Pathways

KEGG:

Virion - Rotavirus
Rap1 signaling pathway
Phagosome
PI3K-Akt signaling pathway
Axon guidance
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules
Tight junction
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Cytoskeleton in muscle cells
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Pertussis
Yersinia infection
Leishmaniasis
Toxoplasmosis
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy

Reactome:

Elastic fibre formation
Fibronectin matrix formation
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall
Basigin interactions
Molecules associated with elastic fibres
Integrin cell surface interactions
Laminin interactions
Syndecan interactions
ECM proteoglycans
Signal transduction by L1
Localization of the PINCH-ILK-PARVIN complex to focal adhesions
RHO GTPases Activate Formins
Interleukin-4 and Interleukin-13 signaling
MET activates PTK2 signaling
MET interacts with TNS proteins
HCMV Early Events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN INJURIES, TRAUMATIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal atresia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural tube defect	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10372817		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14612932, 16732726		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27289231		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23677397		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20886051, 29796184		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	9407948		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	28766250		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21272192, 30918899, 34556089, 35029059, 39657893	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	LHGDN	17498594		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	21255062		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31471299		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27289231, 27797376, 30243721		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11436088	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	8093436	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12746897, 22251373, 26055925, 28428266, 7679713, 9059141, 9691097	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35751199, 38022556, 7525343	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23595626, 8317546	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35059464	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	21659381	Inhibit	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	21703394	Inhibit	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27210750		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10594567	Associate	★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	29227167		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	11996105, 16103120		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22386417, 28042869, 29113179, 31092844, 31486485		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	10652291	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29227167	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23238945	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24805830, 26728650, 27197172, 28160423, 28213554, 29636624, 29774124, 29948648, 30502358, 30719702, 30771534, 31579239		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11716783, 24000122, 28829502, 29462126	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16732726, 18787945, 19074826, 19123990, 19533747, 19630967, 19701706, 20516121, 20607601, 21692986, 21884573, 22513363, 22791584, 22894137, 23289672, 23530058, 24805830, 26342198, 26447611, 26728650, 27094578, 28264026, 28306722, 28415760, 29333087, 29463647, 30719702, 31987794, 32053082, 32229309, 32668815, 32711446, 33500458, 33508166, 34237080, 35538070, 36077593, 38031089, 9843973	Associate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	LHGDN	17515951		★☆☆☆☆ Found in Text Mining only
CADASIL	Cadasil	Pubtator	28139819	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	25230369	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23056350, 23849566, 24009701, 24427350, 26497667, 32364676	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	29333087	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22894137	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12174369, 12209735, 12883474, 12918102, 15546505, 15633218, 21442631, 21499307, 21961047, 24388360, 24498348, 25289898, 26280346, 27015362, 27050147, 30279202, 32744687, 35946175, 35982891, 38420809	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14759525	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37603520, 9824613	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22386417, 28042869, 29113179, 31092844, 31486485		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29930482, 30519312		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23441154, 26728244, 29636624, 30719123, 31598171		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23013730	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22925330, 30747824, 32899691, 35628269	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27289231	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	1443050, 17760843, 19781955, 23139422, 30915742, 34445576	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15132756, 15597106, 17573778, 18398683, 25280968, 26716504, 27323814, 31101337, 33887877, 34517553, 35769468	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21067603		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22388103, 23877403, 26497667, 29022892, 29218693		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	17186162		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	18340010		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	18340010		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	35338173	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	11884376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	27693578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	11884376		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27693578		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29595698	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	23203064	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	36010590, 9741315	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31081104		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	29770797	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20886051, 29796184		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18973153, 28178656		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34907179	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	28954241	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	28534963		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	14623330, 15731179		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29301866, 30350200		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26493024		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19103643		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25386078	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30883691	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29515334, 31215867		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15757908		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	39333335	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24498407, 24777809, 24807392, 25387809, 25894721, 29636624, 30784076, 30863155, 31423176, 31519588, 31676872, 31704841, 31801971		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12865932, 15723653, 15757908, 17898132, 19930715, 22449099, 22898815, 24498407, 26722470, 27655687, 31763673, 32629699, 33345684, 35266011, 36389763, 8314518	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	8353041	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	1395097	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	11884376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Contracture	Contracture	Pubtator	19214689	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25092917, 28498731, 30915742		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30844764	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23625284		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24289792, 30854241		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29040328		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37540585	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	8599470		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21866211, 35240786	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	8415754	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33149760	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25371288		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	35721704	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	9758448		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	31987794	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21935603, 27224909	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15645131		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19228591, 38164180	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	26357653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	26357653	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	34913072	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermolysis Bullosa Junctional	Junctional epidermolysis bullosa	Pubtator	10652291	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21426305		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26898710	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35752862, 36290884	Associate	★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Inhibit	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	29247345		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	29247345		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	23482612		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	LHGDN	16459165		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30279202	Associate	★☆☆☆☆ Found in Text Mining only
Galloway Mowat syndrome	Galloway-Mowat Syndrome	BEFREE	18594871		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	23455756		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	28534963		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18947333, 24358143, 27770278, 37887342	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27770278		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27770278, 31601895		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	11805102, 17888902		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11805102, 21775821, 25093489, 26108662, 27589728, 28161812, 33036421, 37928523	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27589728, 31395336		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	39271482	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	9218832	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	9758448		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	26676755		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	9218832	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21463917, 30642292		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	30642292	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35090306	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	11884376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	11884376		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	16456130		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	39368581	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	22139635	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	7706478	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	25387809		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	33683746	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	23455756		★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	23455756		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29218693, 35946175	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29805477		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18795102	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35864742	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29596443		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30370584	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformation	Intracranial Arteriovenous Malformation	LHGDN	16385340		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	36934253	Inhibit	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29066510		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17514628		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	30271355		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17760843	Associate	★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	11884376		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	23023061, 32417359	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11080495, 12393420	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12393420		★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	16412063	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11264180, 17420287, 32203165	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11264180		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	9407948		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15567743, 17997226		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21499307, 21961047, 24498348, 25089569, 25805567, 29431199, 29746931, 29966664, 30664185, 7539239		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26493024		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29786754	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	7539239		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10607488	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12020426		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22266541, 25280968, 26498639, 27041993, 27096894, 30194450, 31789390, 32069989, 32549766, 8080732, 8385084	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17469136, 30777133	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17469136		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	2646323		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23441154		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26722470	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28829502, 36456612, 36632222	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	9949180		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	31657647		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21463917, 30642292		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24805830, 26728650, 27197172, 28160423, 28213554, 28361350, 29636624, 29774124, 29948648, 30502358, 30719702, 30771534, 31579239		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29930482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23441154, 26728244, 29636624, 30719123, 31598171		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22388103, 23877403, 26497667, 29218693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22382453, 22695923, 24004467, 27289231, 28560430, 29072694, 29636624, 30243721, 31061236, 31693728		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25111005, 26509963, 28744329, 29402961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21618249, 24870620, 25741138, 26903137, 27832972, 28542982		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22386417, 28042869, 29113179, 31092844, 31486485		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17473381, 22695923, 22740085, 24004467, 24718718, 24762228, 24794433, 26497667, 27742688, 28699810, 28925394, 29197149, 29900640, 30611077, 31101337, 31586190		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29515334, 31215867		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19074826		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28969074		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	18794852		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18794852	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20886051, 29796184		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11571298, 15846299, 17380111, 22832488, 23056350, 23522389, 24292944, 25216363, 28264026, 33373316, 8006453, 8868467	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11996105, 12218055, 12376466, 15292257, 17352405, 18632734		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28284838, 28476030		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23238945		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23238945	Associate	★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	1827080		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19781955	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	35240786	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	1968709, 1978561, 2572537, 8094065		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10848782, 11535527, 11751905, 12358905, 15730850, 26282073, 26848618, 8260708, 9649209	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	18615555, 19057841		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18850009, 26848618, 31586190		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26881265	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	8697624	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	27919749		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	1384339	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24135056	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	18340010		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	11884376		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15978110		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	33982786	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28613134, 30779921, 31632090		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28613134, 31523184	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22981873	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15289739, 19829083, 20940399, 22695923, 22736596, 24807392, 24931361, 25359494, 25741138, 25805567, 25894721, 26334393, 26497667, 27004522, 27289231, 27402613, 28161812, 28448494, 28537888, 29402961, 29510995, 29930482, 29966664, 30779921, 30926634, 31092844, 31128008, 31166991, 31523184, 31711924		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	30415495		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	30415495	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	15256055, 1839359, 21741930, 23889963, 33452207	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29221151		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21053345, 26509557, 27207836, 28537888, 31598171, 31696479		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	21478906		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26956208	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35240786	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33303888	Associate	★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	Pubtator	20378539	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29843046		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12054567		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21421073, 2521862, 28054649, 30399378		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27608849	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	26497667	Stimulate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12517798		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22388103, 23877403, 26497667, 29218693		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10329605, 11733357, 15798771, 19028702, 23552693, 26175151, 29218693, 29700289, 34654724, 35379775, 36632222, 36717550, 37577760, 8623916	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23013730, 26497667	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22382453, 22695923, 24004467, 27289231, 28560430, 29072694, 29636624, 30243721, 31061236, 31693728		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27797376		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12931024, 16504015, 16547500, 17312461, 17726369		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16209712, 16504015, 19825166, 22232555, 24004467, 25215932, 27289231, 28418095, 29777904, 31061236, 31693728, 31928012, 32194036, 33073486, 33591944, 34638957, 35275973, 35648752, 35979350	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17496331	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	17496331	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23388428		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	8052162	Stimulate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29600404		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	17515951	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25111005, 26509963, 28744329, 29402961		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12372334, 15500293, 17638891, 18512729, 19123990		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20333644, 20531279, 22378065, 22782340, 22809628, 23106339, 23532895, 23849566, 25111005, 26509963, 29402961, 32630092, 33514011	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	35848967	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16820945		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28498731		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29774124		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	26283883	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	35671035	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	35957513	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10623863, 30342345, 31471299, 7679713		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17530710		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	9176534, 9797497	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	19781955	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	28766250	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10550329	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30813134		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30813134	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	8484693	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25278585, 27796667		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30688657		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	21063403	Associate	★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	26873628	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17573778, 19020712		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21198869, 22740085, 24718718, 25158264, 28237246		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21401805		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26334393, 28401009, 30988666		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19130304, 20237901, 21112327, 22333601, 24192080, 24769516, 25647013, 30642292, 32728068, 33887877	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31144312		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22829201, 29423074, 30642292, 31422211		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	25158264		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24870620, 25741138, 26903137, 27832972, 28542982		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16773720		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16773720, 18356158, 19916173, 24009701, 25230369, 25741138, 25884934, 27836001, 35864742, 37667169	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34326374, 38129820	Stimulate	★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	15054814	Associate	★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	12956766	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37733241	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31392080		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	9218832	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24982892, 27589736, 29288363, 35285795, 36968231	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26675717, 27563827, 28361350		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	18340010		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22486997, 25386078, 29596443		★☆☆☆☆ Found in Text Mining only
Ureteral Obstruction	Urethral obstruction	Pubtator	25477471	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24006305, 27367032, 28042869, 31486485, 39521858, 8178925	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	31059065	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30293085, 37449209	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35090306	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23482612		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	30536538	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	36245842	Associate	★☆☆☆☆ Found in Text Mining only