ITGAX (integrin subunit alpha X)

Gene

• Entrez ID: 3687
• Gene name: Integrin subunit alpha X
• Gene symbol: ITGAX
• Synonyms (NCBI Gene): CD11C, SLEB6
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030204	hsa-miR-26b-5p	Microarray	19088304
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073964	hsa-miR-2114	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT1073967	hsa-miR-338-3p	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073969	hsa-miR-3664-3p	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073972	hsa-miR-4433	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073974	hsa-miR-4768-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073976	hsa-miR-510	CLIP-seq
MIRT1073977	hsa-miR-512-5p	CLIP-seq
MIRT1073978	hsa-miR-542-3p	CLIP-seq
MIRT1073979	hsa-miR-550a	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT2018286	hsa-miR-3181	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT2018287	hsa-miR-4649-5p	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT2250143	hsa-miR-298	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT2250144	hsa-miR-3944-5p	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073978	hsa-miR-542-3p	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT2250145	hsa-miR-922	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT2018286	hsa-miR-3181	CLIP-seq
MIRT2018287	hsa-miR-4649-5p	CLIP-seq
MIRT2250143	hsa-miR-298	CLIP-seq
MIRT2250144	hsa-miR-3944-5p	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT2553697	hsa-miR-3613-3p	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT2553698	hsa-miR-371-5p	CLIP-seq
MIRT2553699	hsa-miR-371b-5p	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073978	hsa-miR-542-3p	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT2553697	hsa-miR-3613-3p	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT2553698	hsa-miR-371-5p	CLIP-seq
MIRT2553699	hsa-miR-371b-5p	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Activation	9360988
JUN	Unknown	8649405;8649434
NFKB1	Unknown	7678251
RELA	Unknown	7678251
SP1	Unknown	7678251;8649405
SPI1	Repression	9295016
SPI1	Unknown	7678251
WT1	Activation	9484784

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	TAS	8020569
GO:0005515	Function	Protein binding	IPI	17726152, 20033057, 20679211
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2303426
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	19693543
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	30873824
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	2303426
GO:0009887	Process	Animal organ morphogenesis	TAS	3327687
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IC	20563599
GO:0009986	Component	Cell surface	IDA	19234460
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	30873824
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	30873824
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	30873824
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0031643	Process	Positive regulation of myelination	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0034689	Component	Integrin alphaX-beta2 complex	IBA
GO:0034689	Component	Integrin alphaX-beta2 complex	IPI	20033057
GO:0034689	Component	Integrin alphaX-beta2 complex	TAS	8020569
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	TAS	2303426
GO:0045766	Process	Positive regulation of angiogenesis	IMP	30873824
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0070821	Component	Tertiary granule membrane	IEA
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1905956	Process	Positive regulation of endothelial tube morphogenesis	IMP	30873824

Other IDs

• MIM: 151510
• HGNC: 6152
• e!Ensembl: ENSG00000140678

Protein

• UniProt ID: P20702
• Protein name: Integrin alpha-X (CD11 antigen-like family member C) (Leu M5) (Leukocyte adhesion glycoprotein p150,95 alpha chain) (Leukocyte adhesion receptor p150,95) (CD antigen CD11c)
• Protein function: Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis.
• PDB: 1N3Y, 2LUV, 3K6S, 3K71, 3K72, 4NEH, 4NEN, 5ES4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00092	VWA	151 → 328	von Willebrand factor type A domain	Domain
  PF01839	FG-GAP	458 → 495	FG-GAP repeat	Repeat
  PF01839	FG-GAP	521 → 556	FG-GAP repeat	Repeat
  PF08441	Integrin_alpha2	615 → 1015	Integrin alpha	Family
  PF00357	Integrin_alpha	1129 → 1143	Integrin alpha cytoplasmic region	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in monocytes and granulocytes.
• Sequence:

  MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
  NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
  YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
  FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
  HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
  LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
  TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
  VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
  PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
  IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
  DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
  RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
  SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
  LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
  LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
  SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
  GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
  DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
  QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
  MEEANGQIAPENGTQTPSPPSEK

• Sequence length: 1163

Pathways

KEGG:

Complement and coagulation cascades
Regulation of actin cytoskeleton
Tuberculosis

Reactome:

Cell surface interactions at the vascular wall
Integrin cell surface interactions
ECM proteoglycans
Interleukin-4 and Interleukin-13 signaling
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	14759987		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	22382878		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	16764927		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	16764927		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	20382884		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40465637	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30383833		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	26941015, 31696215		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23766264, 25714599, 26112011, 27837103, 28935569, 29622163, 31051414, 31610723		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28978351		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12417058, 18727628, 31061532, 32824307, 39346909, 39925810	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28376277, 31882654	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22909167, 28716863, 31814717		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	23040885		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	25420684	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19800635, 21030716, 23918401, 32824307, 35287505	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23766264, 25714599, 26112011, 27837103, 28935569, 29622163, 31051414, 31610723		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32389013	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21543762, 28457482, 28838763, 30353919		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	32158442	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33815388, 34424567, 38350043	Associate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15291360		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25155097, 27108704, 27309860		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	27108704	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	2049307	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26849056	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30388923		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	36380012	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36946266, 40419887	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19584156		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36798119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23955539		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27986748	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38031731	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19387481	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17556594		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36035865	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767, 36316672	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy, Hereditary	Cerebral Amyloid Angiopathy	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29622163		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23182707		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15291360, 1694698, 28603911		★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	32922405	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29738575, 29917067, 31295268		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17602351, 27001939, 35068859	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19737136	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25546229		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30623416		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	22382878		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20628522	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27727089	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17602351, 32076066	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19664152, 25072499, 30343293		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	35299244	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24895100, 31260672		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	32954523	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32954523, 33675790	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17911589		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	37873933	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17911589		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30894181, 34990410	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15584977	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27095356	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35281591	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22355341		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30356719, 30894181		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12153169, 26968188		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25038256	Associate	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	37099426	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28358435		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28358435	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39387602	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	30567635		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21921589	Associate	★☆☆☆☆ Found in Text Mining only
Familial Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	9056541		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35934868	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29202448		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29202448		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	15730520		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	15730520		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	26309367	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	37600779	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15383564		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35316217	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	26028593, 30042224, 37685869	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32453711	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12393418		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	14688376	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35386700, 8025214	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	9158103	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	12576324, 1694698, 2105060, 28603911, 3391709, 7985490, 8621914		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	LHGDN	12576324, 18580071		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	16252253	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31279905	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27837103		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	35586138	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28091516	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31429865		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	21030716	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36093941	Inhibit	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	GWASCAT_DG	25305756, 26028593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31227791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17602351, 19737136, 28797042, 29743615	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19664152, 27001939, 28797042		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27001939	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	24895100, 31260672		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20357360	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28044051, 28440501, 31576093		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	30223431		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	33729517	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	32265898, 32938960	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11937543, 15055269, 1701669, 17891925, 2783862, 33301193	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	10414592, 10419901, 10601997, 11079033, 12576324, 1694698, 1701669, 23347903, 24903677, 29110361, 34561502, 34710243, 37530550, 38440808, 7688993, 8602628	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11823047, 35924822	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25239423, 33301193	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21520003, 23616009, 9669838		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	35281597	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18308386		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	17036394	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22727562, 26388238	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10607488	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25786178		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11315925	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16178860, 18204098, 19129174, 29058308, 31090539, 31536480, 33777025, 34569195, 37638026, 37675114	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25786178		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18204098, 19129174, 21362770, 25786178, 31536480		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	18204098		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	18204098		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25786178		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	28894563		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11937543, 26968188, 34166375	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26968188		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18500740	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	26757600		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	1701669, 2049307	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30388923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28358435		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23955539		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26309367		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25546229		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	12542483	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	29152725		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17726260		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34691054	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	31183389	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19910635		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	25950010		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	28769122		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34290221, 36536067	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11553588, 29743202		★☆☆☆☆ Found in Text Mining only
Mullerian Aplasia and Hyperandrogenism	Mullerian Aplasia And Hyperandrogenism	BEFREE	31175162		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	7535594		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	11966770, 34424567	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17015755, 28421248		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	12707978		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23714180	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	23918401	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32389013	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30894181		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	30894181	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28605364		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	35371068	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19951374, 25469646		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25361058	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25469646	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10427977, 15034015, 16140964, 16163376, 16709811, 17027283, 18316574, 19212670, 19494278, 19584156, 20053774, 20505139, 21930765, 24681516, 25546229, 26309367, 26757600, 26759006, 26968188, 28421385, 29388277, 29850633, 30619287, 30941232, 31502013, 31660979, 8018922		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	9484784		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	1762294	Associate	★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29202448		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19910635, 23118428, 24030890, 28614714, 30356719, 31577826		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20357360, 27698011, 32188105, 32928872, 33033337	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29617296	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	31554917		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	27196532	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	26823856	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33052561	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	12121227, 20053774		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	32158442	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22904171, 22945299, 23118428		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22904171	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23118428	Stimulate	★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	37600779	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	12121227, 20053774		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16645593, 22271227, 24895100		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	16645593	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	20471070		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	30110631		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16907910	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25420684	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24569375, 25465103		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28557137		★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	33601057	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20032971, 22382878		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	22609476		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	40081680	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	39273179	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29363724		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	32201227	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29626089		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	12153169		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22718118		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29202448		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26309367		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	34864309	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26309367, 34864309	Associate	★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Thromboangiitis obliterans	Pubtator	20529829	Associate	★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	34320404	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30348717		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30348717	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19664152		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	29435587	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	28091516	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	15678279	Associate	★☆☆☆☆ Found in Text Mining only