Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3685
Gene name	Integrin subunit alpha V
Gene symbol	ITGAV
Synonyms (NCBI Gene)	CD51MSK8VNRAVTNR
Chromosome	2
Chromosome location	2q32.1
Summary	The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is

575

Show/Hide all (575)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021641	hsa-miR-142-3p	Microarray	17612493
MIRT024872	hsa-miR-215-5p	Microarray	19074876
MIRT026088	hsa-miR-196a-5p	Sequencing	20371350
MIRT026587	hsa-miR-192-5p	Microarray	19074876
MIRT028372	hsa-miR-32-5p	Sequencing	20371350
MIRT021641	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440423	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT021641	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440423	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT026587	hsa-miR-192-5p	ImmunofluorescenceLuciferase reporter assayWestern blot	26506238
MIRT734989	hsa-miR-429	qRT-PCR	33079247
MIRT735046	hsa-miR-142-5p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	32902370
MIRT1073831	hsa-miR-2053	CLIP-seq
MIRT1073832	hsa-miR-2681	CLIP-seq
MIRT1073833	hsa-miR-331-5p	CLIP-seq
MIRT1073834	hsa-miR-4263	CLIP-seq
MIRT1073835	hsa-miR-4662a-3p	CLIP-seq
MIRT1073836	hsa-miR-4678	CLIP-seq
MIRT1073837	hsa-miR-4775	CLIP-seq
MIRT1073838	hsa-miR-4799-5p	CLIP-seq
MIRT1073839	hsa-miR-569	CLIP-seq
MIRT1073840	hsa-miR-576-5p	CLIP-seq
MIRT1073841	hsa-miR-1183	CLIP-seq
MIRT1073842	hsa-miR-1207-5p	CLIP-seq
MIRT1073843	hsa-miR-1252	CLIP-seq
MIRT1073844	hsa-miR-1273g	CLIP-seq
MIRT1073845	hsa-miR-1284	CLIP-seq
MIRT1073846	hsa-miR-1291	CLIP-seq
MIRT1073847	hsa-miR-129-5p	CLIP-seq
MIRT1073848	hsa-miR-137	CLIP-seq
MIRT1073849	hsa-miR-144	CLIP-seq
MIRT1073850	hsa-miR-146a	CLIP-seq
MIRT1073851	hsa-miR-146b-5p	CLIP-seq
MIRT1073852	hsa-miR-155	CLIP-seq
MIRT1073853	hsa-miR-183	CLIP-seq
MIRT1073854	hsa-miR-188-5p	CLIP-seq
MIRT1073855	hsa-miR-194	CLIP-seq
MIRT1073856	hsa-miR-200b	CLIP-seq
MIRT1073857	hsa-miR-200c	CLIP-seq
MIRT1073858	hsa-miR-203	CLIP-seq
MIRT1073859	hsa-miR-2054	CLIP-seq
MIRT1073860	hsa-miR-2113	CLIP-seq
MIRT1073861	hsa-miR-219-1-3p	CLIP-seq
MIRT1073862	hsa-miR-224	CLIP-seq
MIRT1073863	hsa-miR-25	CLIP-seq
MIRT1073864	hsa-miR-297	CLIP-seq
MIRT1073865	hsa-miR-300	CLIP-seq
MIRT1073866	hsa-miR-3065-5p	CLIP-seq
MIRT1073867	hsa-miR-3133	CLIP-seq
MIRT1073868	hsa-miR-3143	CLIP-seq
MIRT1073869	hsa-miR-3173-3p	CLIP-seq
MIRT1073870	hsa-miR-3174	CLIP-seq
MIRT1073871	hsa-miR-32	CLIP-seq
MIRT1073872	hsa-miR-3200-3p	CLIP-seq
MIRT1073873	hsa-miR-323-3p	CLIP-seq
MIRT1073874	hsa-miR-328	CLIP-seq
MIRT1073875	hsa-miR-340	CLIP-seq
MIRT1073876	hsa-miR-3545-3p	CLIP-seq
MIRT1073877	hsa-miR-3613-3p	CLIP-seq
MIRT1073878	hsa-miR-3614-5p	CLIP-seq
MIRT1073879	hsa-miR-3617	CLIP-seq
MIRT1073880	hsa-miR-3620	CLIP-seq
MIRT1073881	hsa-miR-363	CLIP-seq
MIRT1073882	hsa-miR-365	CLIP-seq
MIRT1073883	hsa-miR-3662	CLIP-seq
MIRT1073884	hsa-miR-367	CLIP-seq
MIRT1073885	hsa-miR-3678-5p	CLIP-seq
MIRT1073886	hsa-miR-371-5p	CLIP-seq
MIRT1073887	hsa-miR-371b-5p	CLIP-seq
MIRT1073888	hsa-miR-374c	CLIP-seq
MIRT1073889	hsa-miR-381	CLIP-seq
MIRT1073890	hsa-miR-3924	CLIP-seq
MIRT1073891	hsa-miR-410	CLIP-seq
MIRT1073892	hsa-miR-4257	CLIP-seq
MIRT1073893	hsa-miR-4269	CLIP-seq
MIRT1073894	hsa-miR-4276	CLIP-seq
MIRT1073895	hsa-miR-4280	CLIP-seq
MIRT1073896	hsa-miR-4311	CLIP-seq
MIRT1073897	hsa-miR-4325	CLIP-seq
MIRT1073898	hsa-miR-4421	CLIP-seq
MIRT1073899	hsa-miR-4423-5p	CLIP-seq
MIRT1073900	hsa-miR-4428	CLIP-seq
MIRT1073901	hsa-miR-4434	CLIP-seq
MIRT1073902	hsa-miR-4477a	CLIP-seq
MIRT1073903	hsa-miR-4511	CLIP-seq
MIRT1073904	hsa-miR-4514	CLIP-seq
MIRT1073905	hsa-miR-4516	CLIP-seq
MIRT1073906	hsa-miR-4517	CLIP-seq
MIRT1073907	hsa-miR-4539	CLIP-seq
MIRT1073908	hsa-miR-4637	CLIP-seq
MIRT1073909	hsa-miR-4666-3p	CLIP-seq
MIRT1073910	hsa-miR-4672	CLIP-seq
MIRT1073911	hsa-miR-4692	CLIP-seq
MIRT1073912	hsa-miR-4720-3p	CLIP-seq
MIRT1073913	hsa-miR-4724-3p	CLIP-seq
MIRT1073914	hsa-miR-4731-3p	CLIP-seq
MIRT1073915	hsa-miR-4736	CLIP-seq
MIRT1073916	hsa-miR-4742-5p	CLIP-seq
MIRT1073917	hsa-miR-4763-3p	CLIP-seq
MIRT1073918	hsa-miR-4780	CLIP-seq
MIRT1073919	hsa-miR-4795-3p	CLIP-seq
MIRT1073920	hsa-miR-4801	CLIP-seq
MIRT1073921	hsa-miR-4804-3p	CLIP-seq
MIRT1073922	hsa-miR-486-5p	CLIP-seq
MIRT1073923	hsa-miR-495	CLIP-seq
MIRT1073924	hsa-miR-496	CLIP-seq
MIRT1073925	hsa-miR-509-3p	CLIP-seq
MIRT1073926	hsa-miR-543	CLIP-seq
MIRT1073927	hsa-miR-548a-5p	CLIP-seq
MIRT1073928	hsa-miR-548ab	CLIP-seq
MIRT1073929	hsa-miR-548ac	CLIP-seq
MIRT1073930	hsa-miR-548ae	CLIP-seq
MIRT1073931	hsa-miR-548aj	CLIP-seq
MIRT1073932	hsa-miR-548ak	CLIP-seq
MIRT1073933	hsa-miR-548am	CLIP-seq
MIRT1073934	hsa-miR-548b-5p	CLIP-seq
MIRT1073935	hsa-miR-548c-5p	CLIP-seq
MIRT1073936	hsa-miR-548d-3p	CLIP-seq
MIRT1073937	hsa-miR-548d-5p	CLIP-seq
MIRT1073938	hsa-miR-548g	CLIP-seq
MIRT1073939	hsa-miR-548h	CLIP-seq
MIRT1073940	hsa-miR-548i	CLIP-seq
MIRT1073941	hsa-miR-548j	CLIP-seq
MIRT1073942	hsa-miR-548k	CLIP-seq
MIRT1073943	hsa-miR-548l	CLIP-seq
MIRT1073944	hsa-miR-548w	CLIP-seq
MIRT1073945	hsa-miR-548x	CLIP-seq
MIRT1073946	hsa-miR-548y	CLIP-seq
MIRT1073947	hsa-miR-548z	CLIP-seq
MIRT1073948	hsa-miR-559	CLIP-seq
MIRT1073949	hsa-miR-561	CLIP-seq
MIRT1073950	hsa-miR-563	CLIP-seq
MIRT1073951	hsa-miR-567	CLIP-seq
MIRT1073839	hsa-miR-569	CLIP-seq
MIRT1073952	hsa-miR-571	CLIP-seq
MIRT1073953	hsa-miR-580	CLIP-seq
MIRT1073954	hsa-miR-589	CLIP-seq
MIRT1073955	hsa-miR-590-3p	CLIP-seq
MIRT1073956	hsa-miR-623	CLIP-seq
MIRT1073957	hsa-miR-640	CLIP-seq
MIRT1073958	hsa-miR-641	CLIP-seq
MIRT1073959	hsa-miR-654-3p	CLIP-seq
MIRT1073960	hsa-miR-655	CLIP-seq
MIRT1073961	hsa-miR-92a	CLIP-seq
MIRT1073962	hsa-miR-92b	CLIP-seq
MIRT1550307	hsa-miR-1224-5p	CLIP-seq
MIRT1550308	hsa-miR-1276	CLIP-seq
MIRT1073896	hsa-miR-4311	CLIP-seq
MIRT1550309	hsa-miR-4751	CLIP-seq
MIRT1073929	hsa-miR-548ac	CLIP-seq
MIRT1073930	hsa-miR-548ae	CLIP-seq
MIRT1073931	hsa-miR-548aj	CLIP-seq
MIRT1073933	hsa-miR-548am	CLIP-seq
MIRT1073936	hsa-miR-548d-3p	CLIP-seq
MIRT1073945	hsa-miR-548x	CLIP-seq
MIRT1073947	hsa-miR-548z	CLIP-seq
MIRT1550310	hsa-miR-583	CLIP-seq
MIRT1073841	hsa-miR-1183	CLIP-seq
MIRT2018233	hsa-miR-1258	CLIP-seq
MIRT2018234	hsa-miR-136	CLIP-seq
MIRT1073848	hsa-miR-137	CLIP-seq
MIRT2018235	hsa-miR-141	CLIP-seq
MIRT2018236	hsa-miR-150	CLIP-seq
MIRT1073855	hsa-miR-194	CLIP-seq
MIRT2018237	hsa-miR-200a	CLIP-seq
MIRT1073865	hsa-miR-300	CLIP-seq
MIRT2018238	hsa-miR-3074-3p	CLIP-seq
MIRT2018239	hsa-miR-3120-5p	CLIP-seq
MIRT2018240	hsa-miR-3129-3p	CLIP-seq
MIRT2018241	hsa-miR-3152-5p	CLIP-seq
MIRT2018242	hsa-miR-3156-5p	CLIP-seq
MIRT1073872	hsa-miR-3200-3p	CLIP-seq
MIRT1073873	hsa-miR-323-3p	CLIP-seq
MIRT1073833	hsa-miR-331-5p	CLIP-seq
MIRT2018243	hsa-miR-361-5p	CLIP-seq
MIRT1073889	hsa-miR-381	CLIP-seq
MIRT2018244	hsa-miR-3941	CLIP-seq
MIRT1073892	hsa-miR-4257	CLIP-seq
MIRT1073834	hsa-miR-4263	CLIP-seq
MIRT1073893	hsa-miR-4269	CLIP-seq
MIRT2018245	hsa-miR-4282	CLIP-seq
MIRT2018246	hsa-miR-4328	CLIP-seq
MIRT1073898	hsa-miR-4421	CLIP-seq
MIRT2018247	hsa-miR-4457	CLIP-seq
MIRT2018248	hsa-miR-4476	CLIP-seq
MIRT1073902	hsa-miR-4477a	CLIP-seq
MIRT2018249	hsa-miR-450b-5p	CLIP-seq
MIRT1073904	hsa-miR-4514	CLIP-seq
MIRT2018250	hsa-miR-4528	CLIP-seq
MIRT2018251	hsa-miR-4643	CLIP-seq
MIRT2018252	hsa-miR-4652-3p	CLIP-seq
MIRT2018253	hsa-miR-466	CLIP-seq
MIRT1073909	hsa-miR-4666-3p	CLIP-seq
MIRT2018254	hsa-miR-4666-5p	CLIP-seq
MIRT1073910	hsa-miR-4672	CLIP-seq
MIRT2018255	hsa-miR-4676-5p	CLIP-seq
MIRT1073836	hsa-miR-4678	CLIP-seq
MIRT1073911	hsa-miR-4692	CLIP-seq
MIRT2018256	hsa-miR-4704-3p	CLIP-seq
MIRT2018257	hsa-miR-4713-5p	CLIP-seq
MIRT1073912	hsa-miR-4720-3p	CLIP-seq
MIRT1073913	hsa-miR-4724-3p	CLIP-seq
MIRT2018258	hsa-miR-4727-5p	CLIP-seq
MIRT2018259	hsa-miR-4735-5p	CLIP-seq
MIRT1073916	hsa-miR-4742-5p	CLIP-seq
MIRT2018260	hsa-miR-4766-5p	CLIP-seq
MIRT2018261	hsa-miR-4769-3p	CLIP-seq
MIRT2018262	hsa-miR-4774-3p	CLIP-seq
MIRT1073837	hsa-miR-4775	CLIP-seq
MIRT2018263	hsa-miR-4778-5p	CLIP-seq
MIRT2018264	hsa-miR-4789-3p	CLIP-seq
MIRT2018265	hsa-miR-4789-5p	CLIP-seq
MIRT1073921	hsa-miR-4804-3p	CLIP-seq
MIRT1073922	hsa-miR-486-5p	CLIP-seq
MIRT2018266	hsa-miR-507	CLIP-seq
MIRT2018267	hsa-miR-513b	CLIP-seq
MIRT2018268	hsa-miR-515-5p	CLIP-seq
MIRT2018269	hsa-miR-520d-5p	CLIP-seq
MIRT2018270	hsa-miR-524-5p	CLIP-seq
MIRT2018271	hsa-miR-532-3p	CLIP-seq
MIRT2018272	hsa-miR-548a-3p	CLIP-seq
MIRT1073927	hsa-miR-548a-5p	CLIP-seq
MIRT1073928	hsa-miR-548ab	CLIP-seq
MIRT1073932	hsa-miR-548ak	CLIP-seq
MIRT1073934	hsa-miR-548b-5p	CLIP-seq
MIRT1073935	hsa-miR-548c-5p	CLIP-seq
MIRT1073937	hsa-miR-548d-5p	CLIP-seq
MIRT2018273	hsa-miR-548e	CLIP-seq
MIRT2018274	hsa-miR-548f	CLIP-seq
MIRT1073938	hsa-miR-548g	CLIP-seq
MIRT1073939	hsa-miR-548h	CLIP-seq
MIRT1073940	hsa-miR-548i	CLIP-seq
MIRT1073941	hsa-miR-548j	CLIP-seq
MIRT1073942	hsa-miR-548k	CLIP-seq
MIRT2018275	hsa-miR-548n	CLIP-seq
MIRT2018276	hsa-miR-548p	CLIP-seq
MIRT1073944	hsa-miR-548w	CLIP-seq
MIRT1073946	hsa-miR-548y	CLIP-seq
MIRT2018277	hsa-miR-557	CLIP-seq
MIRT1073948	hsa-miR-559	CLIP-seq
MIRT2018278	hsa-miR-575	CLIP-seq
MIRT1073840	hsa-miR-576-5p	CLIP-seq
MIRT2018279	hsa-miR-579	CLIP-seq
MIRT1073955	hsa-miR-590-3p	CLIP-seq
MIRT2018280	hsa-miR-607	CLIP-seq
MIRT2018281	hsa-miR-630	CLIP-seq
MIRT2018282	hsa-miR-664	CLIP-seq
MIRT2018283	hsa-miR-889	CLIP-seq
MIRT2018284	hsa-miR-891b	CLIP-seq
MIRT2018285	hsa-miR-944	CLIP-seq
MIRT2250113	hsa-miR-1229	CLIP-seq
MIRT2250114	hsa-miR-1273f	CLIP-seq
MIRT2250115	hsa-miR-143	CLIP-seq
MIRT1073850	hsa-miR-146a	CLIP-seq
MIRT1073851	hsa-miR-146b-5p	CLIP-seq
MIRT2250116	hsa-miR-197	CLIP-seq
MIRT2250117	hsa-miR-216b	CLIP-seq
MIRT1073863	hsa-miR-25	CLIP-seq
MIRT2250118	hsa-miR-298	CLIP-seq
MIRT2250119	hsa-miR-299-3p	CLIP-seq
MIRT1073865	hsa-miR-300	CLIP-seq
MIRT1073866	hsa-miR-3065-5p	CLIP-seq
MIRT2250120	hsa-miR-3119	CLIP-seq
MIRT2018239	hsa-miR-3120-5p	CLIP-seq
MIRT2250121	hsa-miR-3145-3p	CLIP-seq
MIRT2250122	hsa-miR-3154	CLIP-seq
MIRT2250123	hsa-miR-3163	CLIP-seq
MIRT2250124	hsa-miR-3180-5p	CLIP-seq
MIRT1073871	hsa-miR-32	CLIP-seq
MIRT1073872	hsa-miR-3200-3p	CLIP-seq
MIRT1073833	hsa-miR-331-5p	CLIP-seq
MIRT1073875	hsa-miR-340	CLIP-seq
MIRT2250125	hsa-miR-3619-3p	CLIP-seq
MIRT1073881	hsa-miR-363	CLIP-seq
MIRT1073884	hsa-miR-367	CLIP-seq
MIRT1073889	hsa-miR-381	CLIP-seq
MIRT2250126	hsa-miR-4287	CLIP-seq
MIRT2250127	hsa-miR-4293	CLIP-seq
MIRT2250128	hsa-miR-4307	CLIP-seq
MIRT1073897	hsa-miR-4325	CLIP-seq
MIRT2018247	hsa-miR-4457	CLIP-seq
MIRT2250129	hsa-miR-4461	CLIP-seq
MIRT2250130	hsa-miR-4469	CLIP-seq
MIRT2250131	hsa-miR-448	CLIP-seq
MIRT2018252	hsa-miR-4652-3p	CLIP-seq
MIRT2250132	hsa-miR-4659a-3p	CLIP-seq
MIRT2250133	hsa-miR-4659b-3p	CLIP-seq
MIRT1073909	hsa-miR-4666-3p	CLIP-seq
MIRT1073836	hsa-miR-4678	CLIP-seq
MIRT2250134	hsa-miR-4685-3p	CLIP-seq
MIRT2250135	hsa-miR-4687-5p	CLIP-seq
MIRT2018256	hsa-miR-4704-3p	CLIP-seq
MIRT2250136	hsa-miR-4708-5p	CLIP-seq
MIRT2250137	hsa-miR-4760-3p	CLIP-seq
MIRT2250138	hsa-miR-4762-5p	CLIP-seq
MIRT2250139	hsa-miR-4770	CLIP-seq
MIRT2250140	hsa-miR-4776-5p	CLIP-seq
MIRT2250141	hsa-miR-498	CLIP-seq
MIRT2018267	hsa-miR-513b	CLIP-seq
MIRT2018268	hsa-miR-515-5p	CLIP-seq
MIRT2018272	hsa-miR-548a-3p	CLIP-seq
MIRT2018273	hsa-miR-548e	CLIP-seq
MIRT2018274	hsa-miR-548f	CLIP-seq
MIRT2018279	hsa-miR-579	CLIP-seq
MIRT1073953	hsa-miR-580	CLIP-seq
MIRT1073954	hsa-miR-589	CLIP-seq
MIRT2018282	hsa-miR-664	CLIP-seq
MIRT1073961	hsa-miR-92a	CLIP-seq
MIRT1073962	hsa-miR-92b	CLIP-seq
MIRT2250142	hsa-miR-942	CLIP-seq
MIRT1073866	hsa-miR-3065-5p	CLIP-seq
MIRT1073949	hsa-miR-561	CLIP-seq
MIRT1073842	hsa-miR-1207-5p	CLIP-seq
MIRT2018233	hsa-miR-1258	CLIP-seq
MIRT1073844	hsa-miR-1273g	CLIP-seq
MIRT2553665	hsa-miR-1290	CLIP-seq
MIRT1073846	hsa-miR-1291	CLIP-seq
MIRT2553666	hsa-miR-135a	CLIP-seq
MIRT2553667	hsa-miR-135b	CLIP-seq
MIRT1073848	hsa-miR-137	CLIP-seq
MIRT2018235	hsa-miR-141	CLIP-seq
MIRT2018236	hsa-miR-150	CLIP-seq
MIRT1073852	hsa-miR-155	CLIP-seq
MIRT1073855	hsa-miR-194	CLIP-seq
MIRT2018237	hsa-miR-200a	CLIP-seq
MIRT1073860	hsa-miR-2113	CLIP-seq
MIRT2553668	hsa-miR-214	CLIP-seq
MIRT1073861	hsa-miR-219-1-3p	CLIP-seq
MIRT2553669	hsa-miR-2277-3p	CLIP-seq
MIRT1073863	hsa-miR-25	CLIP-seq
MIRT2250119	hsa-miR-299-3p	CLIP-seq
MIRT1073865	hsa-miR-300	CLIP-seq
MIRT1073866	hsa-miR-3065-5p	CLIP-seq
MIRT2018238	hsa-miR-3074-3p	CLIP-seq
MIRT2250120	hsa-miR-3119	CLIP-seq
MIRT2018239	hsa-miR-3120-5p	CLIP-seq
MIRT2250121	hsa-miR-3145-3p	CLIP-seq
MIRT2018241	hsa-miR-3152-5p	CLIP-seq
MIRT2018242	hsa-miR-3156-5p	CLIP-seq
MIRT2250123	hsa-miR-3163	CLIP-seq
MIRT2553670	hsa-miR-3164	CLIP-seq
MIRT2553671	hsa-miR-3167	CLIP-seq
MIRT1073870	hsa-miR-3174	CLIP-seq
MIRT2553672	hsa-miR-3185	CLIP-seq
MIRT1073871	hsa-miR-32	CLIP-seq
MIRT1073872	hsa-miR-3200-3p	CLIP-seq
MIRT1073873	hsa-miR-323-3p	CLIP-seq
MIRT1073874	hsa-miR-328	CLIP-seq
MIRT1073833	hsa-miR-331-5p	CLIP-seq
MIRT2553673	hsa-miR-338-5p	CLIP-seq
MIRT1073877	hsa-miR-3613-3p	CLIP-seq
MIRT1073878	hsa-miR-3614-5p	CLIP-seq
MIRT2018243	hsa-miR-361-5p	CLIP-seq
MIRT2553674	hsa-miR-3619-5p	CLIP-seq
MIRT1073881	hsa-miR-363	CLIP-seq
MIRT2553675	hsa-miR-3646	CLIP-seq
MIRT1073882	hsa-miR-365	CLIP-seq
MIRT1073883	hsa-miR-3662	CLIP-seq
MIRT1073884	hsa-miR-367	CLIP-seq
MIRT1073886	hsa-miR-371-5p	CLIP-seq
MIRT1073887	hsa-miR-371b-5p	CLIP-seq
MIRT1073889	hsa-miR-381	CLIP-seq
MIRT2018244	hsa-miR-3941	CLIP-seq
MIRT2553676	hsa-miR-3942-3p	CLIP-seq
MIRT2553677	hsa-miR-3978	CLIP-seq
MIRT1073891	hsa-miR-410	CLIP-seq
MIRT1073892	hsa-miR-4257	CLIP-seq
MIRT1073894	hsa-miR-4276	CLIP-seq
MIRT2018245	hsa-miR-4282	CLIP-seq
MIRT2553678	hsa-miR-4291	CLIP-seq
MIRT1073899	hsa-miR-4423-5p	CLIP-seq
MIRT2553679	hsa-miR-4474-3p	CLIP-seq
MIRT2018248	hsa-miR-4476	CLIP-seq
MIRT1073902	hsa-miR-4477a	CLIP-seq
MIRT2250131	hsa-miR-448	CLIP-seq
MIRT2553680	hsa-miR-4491	CLIP-seq
MIRT2553681	hsa-miR-4499	CLIP-seq
MIRT2553682	hsa-miR-4503	CLIP-seq
MIRT2018249	hsa-miR-450b-5p	CLIP-seq
MIRT2018250	hsa-miR-4528	CLIP-seq
MIRT1073908	hsa-miR-4637	CLIP-seq
MIRT2018251	hsa-miR-4643	CLIP-seq
MIRT2018252	hsa-miR-4652-3p	CLIP-seq
MIRT2553683	hsa-miR-4657	CLIP-seq
MIRT2250132	hsa-miR-4659a-3p	CLIP-seq
MIRT2250133	hsa-miR-4659b-3p	CLIP-seq
MIRT2018253	hsa-miR-466	CLIP-seq
MIRT1073909	hsa-miR-4666-3p	CLIP-seq
MIRT1073910	hsa-miR-4672	CLIP-seq
MIRT1073836	hsa-miR-4678	CLIP-seq
MIRT2553684	hsa-miR-4698	CLIP-seq
MIRT2018257	hsa-miR-4713-5p	CLIP-seq
MIRT2553685	hsa-miR-4715-3p	CLIP-seq
MIRT2553686	hsa-miR-4717-3p	CLIP-seq
MIRT1073912	hsa-miR-4720-3p	CLIP-seq
MIRT1073913	hsa-miR-4724-3p	CLIP-seq
MIRT2018258	hsa-miR-4727-5p	CLIP-seq
MIRT1073915	hsa-miR-4736	CLIP-seq
MIRT1073916	hsa-miR-4742-5p	CLIP-seq
MIRT2250138	hsa-miR-4762-5p	CLIP-seq
MIRT1073917	hsa-miR-4763-3p	CLIP-seq
MIRT2553687	hsa-miR-4766-3p	CLIP-seq
MIRT2018260	hsa-miR-4766-5p	CLIP-seq
MIRT2018261	hsa-miR-4769-3p	CLIP-seq
MIRT2553688	hsa-miR-4773	CLIP-seq
MIRT2018262	hsa-miR-4774-3p	CLIP-seq
MIRT2553689	hsa-miR-4776-3p	CLIP-seq
MIRT2018263	hsa-miR-4778-5p	CLIP-seq
MIRT2018264	hsa-miR-4789-3p	CLIP-seq
MIRT1073921	hsa-miR-4804-3p	CLIP-seq
MIRT1073922	hsa-miR-486-5p	CLIP-seq
MIRT1073923	hsa-miR-495	CLIP-seq
MIRT2553690	hsa-miR-500a	CLIP-seq
MIRT2018266	hsa-miR-507	CLIP-seq
MIRT1073925	hsa-miR-509-3p	CLIP-seq
MIRT2553691	hsa-miR-513c	CLIP-seq
MIRT2553692	hsa-miR-514b-5p	CLIP-seq
MIRT2018268	hsa-miR-515-5p	CLIP-seq
MIRT2018269	hsa-miR-520d-5p	CLIP-seq
MIRT2018270	hsa-miR-524-5p	CLIP-seq
MIRT2018271	hsa-miR-532-3p	CLIP-seq
MIRT2018272	hsa-miR-548a-3p	CLIP-seq
MIRT2018273	hsa-miR-548e	CLIP-seq
MIRT2018274	hsa-miR-548f	CLIP-seq
MIRT1073938	hsa-miR-548g	CLIP-seq
MIRT2018275	hsa-miR-548n	CLIP-seq
MIRT2018276	hsa-miR-548p	CLIP-seq
MIRT2018277	hsa-miR-557	CLIP-seq
MIRT1073949	hsa-miR-561	CLIP-seq
MIRT1073839	hsa-miR-569	CLIP-seq
MIRT1073952	hsa-miR-571	CLIP-seq
MIRT2018279	hsa-miR-579	CLIP-seq
MIRT1073955	hsa-miR-590-3p	CLIP-seq
MIRT2018282	hsa-miR-664	CLIP-seq
MIRT2553693	hsa-miR-761	CLIP-seq
MIRT2553694	hsa-miR-876-5p	CLIP-seq
MIRT2553695	hsa-miR-888	CLIP-seq
MIRT2018284	hsa-miR-891b	CLIP-seq
MIRT2553696	hsa-miR-922	CLIP-seq
MIRT1073961	hsa-miR-92a	CLIP-seq
MIRT1073962	hsa-miR-92b	CLIP-seq
MIRT2250142	hsa-miR-942	CLIP-seq
MIRT1073842	hsa-miR-1207-5p	CLIP-seq
MIRT2018233	hsa-miR-1258	CLIP-seq
MIRT2682983	hsa-miR-125a-3p	CLIP-seq
MIRT1073844	hsa-miR-1273g	CLIP-seq
MIRT1550308	hsa-miR-1276	CLIP-seq
MIRT2553665	hsa-miR-1290	CLIP-seq
MIRT1073846	hsa-miR-1291	CLIP-seq
MIRT2553666	hsa-miR-135a	CLIP-seq
MIRT2553667	hsa-miR-135b	CLIP-seq
MIRT1073848	hsa-miR-137	CLIP-seq
MIRT2018235	hsa-miR-141	CLIP-seq
MIRT2018236	hsa-miR-150	CLIP-seq
MIRT1073852	hsa-miR-155	CLIP-seq
MIRT1073855	hsa-miR-194	CLIP-seq
MIRT2018237	hsa-miR-200a	CLIP-seq
MIRT1073860	hsa-miR-2113	CLIP-seq
MIRT2553668	hsa-miR-214	CLIP-seq
MIRT1073861	hsa-miR-219-1-3p	CLIP-seq
MIRT2553669	hsa-miR-2277-3p	CLIP-seq
MIRT1073863	hsa-miR-25	CLIP-seq
MIRT2250119	hsa-miR-299-3p	CLIP-seq
MIRT1073865	hsa-miR-300	CLIP-seq
MIRT1073866	hsa-miR-3065-5p	CLIP-seq
MIRT2018238	hsa-miR-3074-3p	CLIP-seq
MIRT2250120	hsa-miR-3119	CLIP-seq
MIRT2018239	hsa-miR-3120-5p	CLIP-seq
MIRT2250121	hsa-miR-3145-3p	CLIP-seq
MIRT2018241	hsa-miR-3152-5p	CLIP-seq
MIRT2018242	hsa-miR-3156-5p	CLIP-seq
MIRT2250123	hsa-miR-3163	CLIP-seq
MIRT2553670	hsa-miR-3164	CLIP-seq
MIRT2553671	hsa-miR-3167	CLIP-seq
MIRT1073870	hsa-miR-3174	CLIP-seq
MIRT2553672	hsa-miR-3185	CLIP-seq
MIRT1073871	hsa-miR-32	CLIP-seq
MIRT1073872	hsa-miR-3200-3p	CLIP-seq
MIRT1073873	hsa-miR-323-3p	CLIP-seq
MIRT1073874	hsa-miR-328	CLIP-seq
MIRT1073833	hsa-miR-331-5p	CLIP-seq
MIRT1073877	hsa-miR-3613-3p	CLIP-seq
MIRT1073878	hsa-miR-3614-5p	CLIP-seq
MIRT2018243	hsa-miR-361-5p	CLIP-seq
MIRT2553674	hsa-miR-3619-5p	CLIP-seq
MIRT1073881	hsa-miR-363	CLIP-seq
MIRT2553675	hsa-miR-3646	CLIP-seq
MIRT1073882	hsa-miR-365	CLIP-seq
MIRT1073883	hsa-miR-3662	CLIP-seq
MIRT1073884	hsa-miR-367	CLIP-seq
MIRT1073886	hsa-miR-371-5p	CLIP-seq
MIRT1073887	hsa-miR-371b-5p	CLIP-seq
MIRT1073889	hsa-miR-381	CLIP-seq
MIRT2682984	hsa-miR-3934	CLIP-seq
MIRT2018244	hsa-miR-3941	CLIP-seq
MIRT2553677	hsa-miR-3978	CLIP-seq
MIRT1073891	hsa-miR-410	CLIP-seq
MIRT1073892	hsa-miR-4257	CLIP-seq
MIRT2682985	hsa-miR-4275	CLIP-seq
MIRT1073894	hsa-miR-4276	CLIP-seq
MIRT2018245	hsa-miR-4282	CLIP-seq
MIRT2553678	hsa-miR-4291	CLIP-seq
MIRT1073899	hsa-miR-4423-5p	CLIP-seq
MIRT2553679	hsa-miR-4474-3p	CLIP-seq
MIRT2018248	hsa-miR-4476	CLIP-seq
MIRT1073902	hsa-miR-4477a	CLIP-seq
MIRT2250131	hsa-miR-448	CLIP-seq
MIRT2553680	hsa-miR-4491	CLIP-seq
MIRT2553681	hsa-miR-4499	CLIP-seq
MIRT2553682	hsa-miR-4503	CLIP-seq
MIRT2018249	hsa-miR-450b-5p	CLIP-seq
MIRT2018250	hsa-miR-4528	CLIP-seq
MIRT1073908	hsa-miR-4637	CLIP-seq
MIRT2018251	hsa-miR-4643	CLIP-seq
MIRT2018252	hsa-miR-4652-3p	CLIP-seq
MIRT2553683	hsa-miR-4657	CLIP-seq
MIRT2250132	hsa-miR-4659a-3p	CLIP-seq
MIRT2250133	hsa-miR-4659b-3p	CLIP-seq
MIRT2018253	hsa-miR-466	CLIP-seq
MIRT1073909	hsa-miR-4666-3p	CLIP-seq
MIRT1073910	hsa-miR-4672	CLIP-seq
MIRT1073836	hsa-miR-4678	CLIP-seq
MIRT2553684	hsa-miR-4698	CLIP-seq
MIRT2018257	hsa-miR-4713-5p	CLIP-seq
MIRT2553686	hsa-miR-4717-3p	CLIP-seq
MIRT1073912	hsa-miR-4720-3p	CLIP-seq
MIRT1073913	hsa-miR-4724-3p	CLIP-seq
MIRT2018258	hsa-miR-4727-5p	CLIP-seq
MIRT1073914	hsa-miR-4731-3p	CLIP-seq
MIRT1073915	hsa-miR-4736	CLIP-seq
MIRT1073916	hsa-miR-4742-5p	CLIP-seq
MIRT2250138	hsa-miR-4762-5p	CLIP-seq
MIRT1073917	hsa-miR-4763-3p	CLIP-seq
MIRT2553687	hsa-miR-4766-3p	CLIP-seq
MIRT2018260	hsa-miR-4766-5p	CLIP-seq
MIRT2018261	hsa-miR-4769-3p	CLIP-seq
MIRT2553688	hsa-miR-4773	CLIP-seq
MIRT2018262	hsa-miR-4774-3p	CLIP-seq
MIRT2553689	hsa-miR-4776-3p	CLIP-seq
MIRT2018263	hsa-miR-4778-5p	CLIP-seq
MIRT2018264	hsa-miR-4789-3p	CLIP-seq
MIRT1073920	hsa-miR-4801	CLIP-seq
MIRT1073921	hsa-miR-4804-3p	CLIP-seq
MIRT1073922	hsa-miR-486-5p	CLIP-seq
MIRT1073923	hsa-miR-495	CLIP-seq
MIRT2553690	hsa-miR-500a	CLIP-seq
MIRT2018266	hsa-miR-507	CLIP-seq
MIRT1073925	hsa-miR-509-3p	CLIP-seq
MIRT2553691	hsa-miR-513c	CLIP-seq
MIRT2553692	hsa-miR-514b-5p	CLIP-seq
MIRT2018268	hsa-miR-515-5p	CLIP-seq
MIRT2018269	hsa-miR-520d-5p	CLIP-seq
MIRT2018270	hsa-miR-524-5p	CLIP-seq
MIRT2018271	hsa-miR-532-3p	CLIP-seq
MIRT2018272	hsa-miR-548a-3p	CLIP-seq
MIRT2018273	hsa-miR-548e	CLIP-seq
MIRT2018274	hsa-miR-548f	CLIP-seq
MIRT1073938	hsa-miR-548g	CLIP-seq
MIRT2018276	hsa-miR-548p	CLIP-seq
MIRT2018277	hsa-miR-557	CLIP-seq
MIRT1073949	hsa-miR-561	CLIP-seq
MIRT1073839	hsa-miR-569	CLIP-seq
MIRT1073952	hsa-miR-571	CLIP-seq
MIRT2018279	hsa-miR-579	CLIP-seq
MIRT1073955	hsa-miR-590-3p	CLIP-seq
MIRT2018282	hsa-miR-664	CLIP-seq
MIRT2553693	hsa-miR-761	CLIP-seq
MIRT2682986	hsa-miR-764	CLIP-seq
MIRT2553694	hsa-miR-876-5p	CLIP-seq
MIRT2553695	hsa-miR-888	CLIP-seq
MIRT2018284	hsa-miR-891b	CLIP-seq
MIRT2553696	hsa-miR-922	CLIP-seq
MIRT1073961	hsa-miR-92a	CLIP-seq
MIRT1073962	hsa-miR-92b	CLIP-seq
MIRT2250142	hsa-miR-942	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
FOSL1	Repression	23319049
HOXD3	Unknown	14610084
JUND	Repression	23319049
SP1	Repression	23319049
SP1	Unknown	12136940
SP3	Unknown	12136940

123

Show/Hide all (123)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEP	11866539
GO:0001568	Process	Blood vessel development	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0001704	Process	Formation of primary germ layer	IEA
GO:0001846	Function	Opsonin binding	IEA
GO:0001846	Function	Opsonin binding	ISS
GO:0001968	Function	Fibronectin binding	IDA	24658351
GO:0002020	Function	Protease binding	IDA	22505472
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IPI	20826760
GO:0005515	Function	Protein binding	IPI	1694173, 2478219, 11546839, 11877390, 11884718, 12695522, 12807887, 15299032, 15611078, 16099422, 17158881, 17925226, 20639902, 21677751, 22178926, 24011356, 24658351, 25383667, 28534487, 31331973, 32814053, 37184585, 38016540
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	21310825
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	11877390
GO:0005886	Component	Plasma membrane	TAS	2430295
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA	17158881, 25063885, 29162887
GO:0005925	Component	Focal adhesion	IEA
GO:0007155	Process	Cell adhesion	IDA	10218736
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IMP	7525578, 24658351
GO:0007160	Process	Cell-matrix adhesion	NAS	11877390, 11970960, 19693543
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	11970960
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	26934001
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	11877390, 19693543
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	19578119
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008305	Component	Integrin complex	IDA	15215180
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	NAS	11877390
GO:0009888	Process	Tissue development	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	19581412, 23658023
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	1918072, 7525578, 19933311, 20563599, 21310825, 22505472, 23154389, 25063885
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IMP	15215180
GO:0010888	Process	Negative regulation of lipid storage	IMP	15215180
GO:0010989	Process	Negative regulation of low-density lipoprotein particle clearance	IMP	15215180
GO:0015026	Function	Coreceptor activity	TAS	23125415
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	IMP	26934001
GO:0017134	Function	Fibroblast growth factor binding	IDA	18441324
GO:0019960	Function	C-X3-C chemokine binding	IDA	23125415
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031258	Component	Lamellipodium membrane	IDA	25063885
GO:0031527	Component	Filopodium membrane	IDA	25063885
GO:0031528	Component	Microvillus membrane	IDA	25063885
GO:0031589	Process	Cell-substrate adhesion	IMP	19933311
GO:0031994	Function	Insulin-like growth factor I binding	IDA	19578119
GO:0032369	Process	Negative regulation of lipid transport	IMP	15215180
GO:0032587	Component	Ruffle membrane	IDA	25063885
GO:0033627	Process	Cell adhesion mediated by integrin	IDA	12807887, 17158881
GO:0033627	Process	Cell adhesion mediated by integrin	IEA
GO:0033690	Process	Positive regulation of osteoblast proliferation	IEA
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IDA	24658351
GO:0034682	Component	Integrin alphav-beta1 complex	IBA
GO:0034682	Component	Integrin alphav-beta1 complex	IPI	25398877
GO:0034683	Component	Integrin alphav-beta3 complex	IDA	20826760, 22505472, 23726972, 24658351, 25063885, 31331973
GO:0034683	Component	Integrin alphav-beta3 complex	IEA
GO:0034683	Component	Integrin alphav-beta3 complex	IPI	11546839
GO:0034684	Component	Integrin alphav-beta5 complex	IDA	25063885
GO:0034684	Component	Integrin alphav-beta5 complex	IEA
GO:0034684	Component	Integrin alphav-beta5 complex	IPI	1694173
GO:0034685	Component	Integrin alphav-beta6 complex	IDA	22278742
GO:0034685	Component	Integrin alphav-beta6 complex	IEA
GO:0034685	Component	Integrin alphav-beta6 complex	IPI	25383667
GO:0034686	Component	Integrin alphav-beta8 complex	IBA
GO:0034686	Component	Integrin alphav-beta8 complex	IDA	1918072, 7525578, 22278742
GO:0034686	Component	Integrin alphav-beta8 complex	IPI	30061598
GO:0035313	Process	Wound healing, spreading of epidermal cells	NAS	19693543
GO:0035579	Component	Specific granule membrane	TAS
GO:0035866	Component	Alphav-beta3 integrin-PKCalpha complex	NAS	16014375
GO:0035867	Component	Alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	19578119
GO:0035868	Component	Alphav-beta3 integrin-HMGB1 complex	IDA	20826760
GO:0035987	Process	Endodermal cell differentiation	IMP	23154389
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038027	Process	Apolipoprotein A-I-mediated signaling pathway	IMP	23726972
GO:0038132	Function	Neuregulin binding	IDA	20682778
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043277	Process	Apoptotic cell clearance	IGI	20826760
GO:0043277	Process	Apoptotic cell clearance	ISS
GO:0045335	Component	Phagocytic vesicle	TAS
GO:0045785	Process	Positive regulation of cell adhesion	IDA	10708943
GO:0046718	Process	Symbiont entry into host cell	IMP	25063885
GO:0046718	Process	Symbiont entry into host cell	TAS	10570297
GO:0046872	Function	Metal ion binding	IEA
GO:0050431	Function	Transforming growth factor beta binding	ISS
GO:0050748	Process	Negative regulation of lipoprotein metabolic process	IMP	15215180
GO:0050764	Process	Regulation of phagocytosis	IDA	10570297
GO:0050840	Function	Extracellular matrix binding	IDA	22505472
GO:0050919	Process	Negative chemotaxis	IMP	23726972
GO:0051057	Process	Positive regulation of small GTPase mediated signal transduction	IMP	26934001
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	ISS
GO:0070588	Process	Calcium ion transmembrane transport	IDA	18395422
GO:0071604	Process	Transforming growth factor beta production	IEA
GO:0085017	Process	Entry into host cell by a symbiont-containing vacuole	NAS	10570297
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	ISS
GO:0098609	Process	Cell-cell adhesion	IBA
GO:1902533	Process	Positive regulation of intracellular signal transduction	IMP	26934001
GO:1990430	Function	Extracellular matrix protein binding	IDA	7525578
GO:2000536	Process	Negative regulation of entry of bacterium into host cell	IDA	10570297
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	10708943

MIM	HGNC	e!Ensembl
193210	6150	ENSG00000138448

P06756

Protein name

Integrin alpha-V (Vitronectin receptor) (Vitronectin receptor subunit alpha) (CD antigen CD51) [Cleaved into: Integrin alpha-V heavy chain; Integrin alpha-V light chain]

Protein function

The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide ar

PDB

1JV2 , 1L5G , 1M1X , 1U8C , 3IJE , 4G1E , 4G1M , 4MMX , 4MMY , 4MMZ , 4O02 , 4UM8 , 4UM9 , 5FFG , 5FFO , 5NEM , 5NER , 5NET , 5NEU , 6AVQ , 6AVR , 6AVU , 6DJP , 6MK0 , 6MSL , 6MSU , 6NAJ , 6OM1 , 6OM2 , 6UJA , 6UJB , 6UJC , 7Y1T , 8IJ5 , 8TCF , 8TCG , 8VS6 , 8VSD , 8W30 , 8XEI , 8XEK , 8XEL , 8XEN , 8XER , 8XEZ , 8XF6 , 8XFG , 8XFO , 9CZ7 , 9CZA , 9CZD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01839	FG-GAP	252 → 286	FG-GAP repeat	Repeat
PF01839	FG-GAP	306 → 348	FG-GAP repeat	Repeat
PF01839	FG-GAP	370 → 406	FG-GAP repeat	Repeat
PF08441	Integrin_alpha2	467 → 914	Integrin alpha	Family
PF00357	Integrin_alpha	1017 → 1031	Integrin alpha cytoplasmic region	Family

Sequence

MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET

Sequence length

1048

Interactions

View interactions

	KEGG		Reactome
	Hormone signaling Phagosome Efferocytosis PI3K-Akt signaling pathway Focal adhesion ECM-receptor interaction Cell adhesion molecules Regulation of actin cytoskeleton Cytoskeleton in muscle cells Thyroid hormone signaling pathway Human cytomegalovirus infection Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Small cell lung cancer Hypertrophic cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy Dilated cardiomyopathy Fluid shear stress and atherosclerosis		Cross-presentation of particulate exogenous antigens (phagosomes) Elastic fibre formation PECAM1 interactions Molecules associated with elastic fibres Integrin cell surface interactions Syndecan interactions ECM proteoglycans VEGFA-VEGFR2 Pathway Signal transduction by L1 Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
IMMUNE DYSREGULATION, NEURODEVELOPMENTAL DEFECTS, AND COLITIS	Pathogenic; Likely pathogenic	rs1357935457, rs1443125036, rs1688922276, rs2468408721	RCV005862551 RCV005862552 RCV005862553 RCV005862554	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ITGAV deficiency	Pathogenic; Likely pathogenic	rs1357935457, rs1443125036, rs1688922276, rs2468408721	RCV004555913 RCV004555914 RCV004555916 RCV004556873	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ITGAV-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (168)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	9445356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15609323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19326399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11911248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19326399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	15994925		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31199988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19326399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11529880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	31519800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15345499, 17615072, 25150077, 28376277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11529880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12099514, 24412187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16672769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	21182210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	18451156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12350512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22072592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25093246, 26689941, 29053416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11172040, 14691052, 20540537, 26657485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11724803, 12874388, 14691052, 16846534, 26657485, 28050799, 29464003, 29498809, 29752407, 35526305, 35763908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	36009051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19893992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17363590, 18427826, 24747441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19893992, 21909361, 23345412, 27145276, 29453316, 29669827, 30215728, 31684995, 36246403, 36429000, 37679418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	35526305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12350512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15756594, 24488787, 25370835, 26449830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21747684, 33099932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35419611, 40520021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25655629, 33850477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19808644, 23640055, 23725446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	17505007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	24412187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	9741315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	9445356		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	21239458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21239458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11911248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38123132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	18191107, 18814143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	30087584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17965775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	34161337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11169447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11299820, 23128103, 25275062, 27593923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20558745, 26674523, 29068474, 31831830, 35266011, 36303457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	11869845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29893581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33201212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33083497, 36303457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10027628, 19171333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12372469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26056923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	1694890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36813090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29855729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	26507873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	30449496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	11869845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	9137089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	39690926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	16153456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	25041566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12881526, 15994925, 22072592, 23704872, 28619756, 29603594, 29882028, 8939197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12881526, 19401596, 22655084, 38009896, 39394177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18394009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12881526, 15994925, 16798098, 22072592, 29603594, 8939197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11572856, 19033423, 19401596, 25093246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16798098, 17145879, 19033423, 23403076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18394009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	32938406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38367239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30367545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32000779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	12645863, 36303457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33201212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformation	Intracranial Arteriovenous Malformation	LHGDN	16385340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	12397091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30087584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	25655629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27248172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29342970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12143051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18694400, 24333181, 27145276, 28094803, 29453316, 30215728, 31285770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27164900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	LHGDN	16675963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22081074, 22132110, 26449830, 26918447, 29053416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	27310302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11172040, 20540537, 21127199, 26657485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24488787, 25370835, 26449830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19808644, 23640055, 23725446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26846197, 31199988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17369840, 23065910, 23559257, 29743605, 31319863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26270236, 31320250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12350512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11529880, 11778901, 17017851, 17028596, 17374519, 17952617, 18427826, 18854176, 20102181, 23640055, 24440971, 26846197, 29743605, 30486830, 31199988, 31320250, 31538956, 9614556 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21239458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12874388, 16790523, 17175151, 17331499, 17550972, 18064530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	33230159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	12213704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11911248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	38009896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10998134, 11553709, 1376331, 22773839, 24412090, 37460977, 7522323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11291042, 11553709, 11778901, 12198771, 1376331, 16631740, 17363590, 21239882, 22773839, 2477382, 27311960, 8806594, 8869681		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12198771, 15509546, 15557124, 15897908, 15998788, 16631740, 18211678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36901697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24595274, 31212858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35320805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29937423, 36231010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12161360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24440971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24440971, 28613134, 36345604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10728589, 10751360, 11291042, 12198771, 14610084, 15618016, 15994925, 16391197, 17374519, 19296102, 19320477, 19541645, 19808644, 19998373, 20027628 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8623914, 9137089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	8623914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22692860, 25370835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21953087, 22662110, 32964955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	24886251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	24886251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	Pubtator	15231021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	17264806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12384999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27310302, 31239718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30691475, 34884541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	16885757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23640055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35295989	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	11872628, 12642872, 18854176		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19808644, 23725446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21747684, 23725446, 27458161, 33155399, 33317907, 33723319, 35053353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26846197, 31199988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30367545, 35419611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26749005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	33693877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	20926544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27186070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	11422734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	21116829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17369840, 23065910, 23559257, 29743605, 31319863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12168086, 14524530, 17034033, 17369840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22966907, 23559257, 24175814, 27058620, 28314844, 29743605, 33514011, 35682554, 37314749, 37862114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29380900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39690926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28363829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28483378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17615072, 18001496, 19818132, 24375314, 25150077, 28376277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17615072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30691475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	16301681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	19563408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	35927660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12009335, 25190218, 25497015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16024014, 17879163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30049512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27108184, 33476742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19581046, 26270236, 31320250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34281542, 36613819, 37036489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	40596960	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	16301681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	9493569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	40423510	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21127199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27484639, 35447298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28590340, 29893581		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21239458	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35038961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	21150164, 26507873		★★★★★ ★☆☆☆☆ Found in Text Mining only

ITGAV (integrin subunit alpha V)