ITGAL (integrin subunit alpha L)

Gene

• Entrez ID: 3683
• Gene name: Integrin subunit alpha L
• Gene symbol: ITGAL
• Synonyms (NCBI Gene): CD11A, LFA-1, LFA1A
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte fu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT1073773	hsa-miR-1227	CLIP-seq
MIRT1073774	hsa-miR-1252	CLIP-seq
MIRT1073775	hsa-miR-1254	CLIP-seq
MIRT1073776	hsa-miR-1290	CLIP-seq
MIRT1073777	hsa-miR-1304	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT1073780	hsa-miR-139-3p	CLIP-seq
MIRT1073781	hsa-miR-218	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT1073784	hsa-miR-3116	CLIP-seq
MIRT1073785	hsa-miR-3126-5p	CLIP-seq
MIRT1073786	hsa-miR-3149	CLIP-seq
MIRT1073787	hsa-miR-3167	CLIP-seq
MIRT1073788	hsa-miR-3650	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT1073790	hsa-miR-3672	CLIP-seq
MIRT1073791	hsa-miR-4294	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073793	hsa-miR-4419a	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT1073795	hsa-miR-4428	CLIP-seq
MIRT1073796	hsa-miR-4438	CLIP-seq
MIRT1073797	hsa-miR-4476	CLIP-seq
MIRT1073798	hsa-miR-4496	CLIP-seq
MIRT1073799	hsa-miR-4510	CLIP-seq
MIRT1073800	hsa-miR-4514	CLIP-seq
MIRT1073801	hsa-miR-4533	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT1073803	hsa-miR-4671-3p	CLIP-seq
MIRT1073804	hsa-miR-4690-3p	CLIP-seq
MIRT1073805	hsa-miR-4692	CLIP-seq
MIRT1073806	hsa-miR-4715-3p	CLIP-seq
MIRT1073807	hsa-miR-5095	CLIP-seq
MIRT1073808	hsa-miR-518a-5p	CLIP-seq
MIRT1073809	hsa-miR-527	CLIP-seq
MIRT1073810	hsa-miR-636	CLIP-seq
MIRT1073811	hsa-miR-720	CLIP-seq
MIRT1073812	hsa-miR-876-5p	CLIP-seq
MIRT1073813	hsa-miR-940	CLIP-seq
MIRT1073814	hsa-miR-4733-5p	CLIP-seq
MIRT1073815	hsa-miR-4761-5p	CLIP-seq
MIRT2018210	hsa-miR-4279	CLIP-seq
MIRT2018211	hsa-miR-106a	CLIP-seq
MIRT2018212	hsa-miR-106b	CLIP-seq
MIRT2018213	hsa-miR-17	CLIP-seq
MIRT2018214	hsa-miR-20a	CLIP-seq
MIRT2018215	hsa-miR-20b	CLIP-seq
MIRT2018216	hsa-miR-302a	CLIP-seq
MIRT2018217	hsa-miR-302b	CLIP-seq
MIRT2018218	hsa-miR-302c	CLIP-seq
MIRT2018219	hsa-miR-302d	CLIP-seq
MIRT2018220	hsa-miR-302e	CLIP-seq
MIRT2018221	hsa-miR-372	CLIP-seq
MIRT2018222	hsa-miR-373	CLIP-seq
MIRT2018223	hsa-miR-512-3p	CLIP-seq
MIRT2018224	hsa-miR-519d	CLIP-seq
MIRT2018225	hsa-miR-520a-3p	CLIP-seq
MIRT2018226	hsa-miR-520b	CLIP-seq
MIRT2018227	hsa-miR-520c-3p	CLIP-seq
MIRT2018228	hsa-miR-520d-3p	CLIP-seq
MIRT2018229	hsa-miR-520e	CLIP-seq
MIRT2018230	hsa-miR-520g	CLIP-seq
MIRT2018231	hsa-miR-520h	CLIP-seq
MIRT2018232	hsa-miR-93	CLIP-seq
MIRT2250096	hsa-miR-1236	CLIP-seq
MIRT1073774	hsa-miR-1252	CLIP-seq
MIRT2250097	hsa-miR-1324	CLIP-seq
MIRT2250098	hsa-miR-1827	CLIP-seq
MIRT2250099	hsa-miR-1915	CLIP-seq
MIRT2250100	hsa-miR-24	CLIP-seq
MIRT2250101	hsa-miR-2467-3p	CLIP-seq
MIRT2250102	hsa-miR-3677-5p	CLIP-seq
MIRT2250103	hsa-miR-4284	CLIP-seq
MIRT1073797	hsa-miR-4476	CLIP-seq
MIRT1073798	hsa-miR-4496	CLIP-seq
MIRT1073801	hsa-miR-4533	CLIP-seq
MIRT2250104	hsa-miR-4726-3p	CLIP-seq
MIRT2250105	hsa-miR-4753-3p	CLIP-seq
MIRT2250106	hsa-miR-4772-3p	CLIP-seq
MIRT2250107	hsa-miR-759	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT2389517	hsa-miR-652	CLIP-seq
MIRT2451998	hsa-miR-122	CLIP-seq
MIRT1073780	hsa-miR-139-3p	CLIP-seq
MIRT2451999	hsa-miR-3135b	CLIP-seq
MIRT2452000	hsa-miR-3652	CLIP-seq
MIRT2452001	hsa-miR-4276	CLIP-seq
MIRT1073791	hsa-miR-4294	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT2452002	hsa-miR-4430	CLIP-seq
MIRT1073811	hsa-miR-720	CLIP-seq
MIRT2452001	hsa-miR-4276	CLIP-seq
MIRT2451998	hsa-miR-122	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT2250100	hsa-miR-24	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT2451999	hsa-miR-3135b	CLIP-seq
MIRT2452000	hsa-miR-3652	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT2250103	hsa-miR-4284	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT2452002	hsa-miR-4430	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT2250106	hsa-miR-4772-3p	CLIP-seq
MIRT2389517	hsa-miR-652	CLIP-seq
MIRT2451998	hsa-miR-122	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT2250100	hsa-miR-24	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT2451999	hsa-miR-3135b	CLIP-seq
MIRT2452000	hsa-miR-3652	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT2250103	hsa-miR-4284	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT2452002	hsa-miR-4430	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT2250106	hsa-miR-4772-3p	CLIP-seq
MIRT2389517	hsa-miR-652	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RFX1	Unknown	21192791

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	2477710
GO:0005515	Function	Protein binding	IPI	11544294, 11812992, 12208882, 12526797, 15946252, 16595626, 18985028, 22956999, 29100055
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006909	Process	Phagocytosis	IEA
GO:0006954	Process	Inflammatory response	NAS	8103515
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	2537322, 8103515
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	2477710
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	2477710, 11812992
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IMP	19029120
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543
GO:0007165	Process	Signal transduction	NAS	8103515
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	19693543
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	NAS	8103515
GO:0008305	Component	Integrin complex	TAS	2537322
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	19029120, 19234460
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030369	Function	ICAM-3 receptor activity	IMP	19029120
GO:0030667	Component	Secretory granule membrane	IEA
GO:0034687	Component	Integrin alphaL-beta2 complex	IBA
GO:0034687	Component	Integrin alphaL-beta2 complex	IDA	19029120
GO:0034687	Component	Integrin alphaL-beta2 complex	NAS	19693543
GO:0035579	Component	Specific granule membrane	TAS
GO:0035683	Process	Memory T cell extravasation	IDA	11812992
GO:0038023	Function	Signaling receptor activity	IBA
GO:0042110	Process	T cell activation	IEA
GO:0043113	Process	Receptor clustering	IMP	19029120
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IMP	19029120
GO:0050839	Function	Cell adhesion molecule binding	IPI	1448173
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098609	Process	Cell-cell adhesion	ISS	12652296

Other IDs

• MIM: 153370
• HGNC: 6148
• e!Ensembl: ENSG00000005844

Protein

• UniProt ID: P20701
• Protein name: Integrin alpha-L (CD11 antigen-like family member A) (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (LFA-1A) (Leukocyte function-associated molecule 1 alpha chain) (CD antigen CD11a)
• Protein function: Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin ITGAL/ITGB2 is a receptor for F11R (PubMed:11812992, PubMed:15528364). Integrin ITGAL/ITGB2 is a receptor for the secreted form of ubiquitin-like protein ISG15; the i
• PDB: 1CQP, 1DGQ, 1LFA, 1MJN, 1MQ8, 1MQ9, 1MQA, 1RD4, 1T0P, 1XDD, 1XDG, 1XUO, 1ZON, 1ZOO, 1ZOP, 2ICA, 2K8O, 2M3E, 2O7N, 3BN3, 3BQM, 3BQN, 3E2M, 3EOA, 3EOB, 3F74, 3F78, 3HI6, 3M6F, 3TCX, 4IXD, 5E6R, 5E6S, 5E6U, 6BXB, 6BXF, 6BXJ, 6CKB, 7KC3, 7KC5, 7KC6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00092	VWA	156 → 326	von Willebrand factor type A domain	Domain
  PF01839	FG-GAP	521 → 554	FG-GAP repeat	Repeat
  PF08441	Integrin_alpha2	612 → 1002	Integrin alpha	Family
  PF00357	Integrin_alpha	1113 → 1127	Integrin alpha cytoplasmic region	Family

• Tissue specificity: TISSUE SPECIFICITY: Leukocytes. {ECO:0000269|PubMed:16301335, ECO:0000269|PubMed:23775590}.
• Sequence:

  MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
  PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
  QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
  DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
  ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
  KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
  GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
  ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
  GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
  VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
  VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
  PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
  LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
  LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
  IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
  NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
  IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
  CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
  VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
  EQLASGQEAGDPGCLKPLHEKDSESGGGKD

• Sequence length: 1170

Pathways

KEGG:

Rap1 signaling pathway
Cell adhesion molecules
Neutrophil extracellular trap formation
Natural killer cell mediated cytotoxicity
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Malaria
Staphylococcus aureus infection
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Rheumatoid arthritis
Viral myocarditis

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall
Integrin cell surface interactions
Neutrophil degranulation
RUNX3 Regulates Immune Response and Cell Migration

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLINICAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF PHARYNX	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONSILLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	23450818		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15108165, 7815843		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	16764927		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	7497527		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	31582539		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11321434, 1356935, 9573029		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	7775666		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25197660	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	1347673	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	15308324, 21173096	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21173096		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Calcification of	Aortic valve disease	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31157518		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15749905		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11310827	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10531076	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10193433	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1575573, 33123735	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10835320		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	7596088, 9864003	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	21192791	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31157518		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11385505, 22206678, 28784685, 29427909		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26884833	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	11435733		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19360456		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	29099772		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	1698024	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16428075, 25155097, 27309860		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	CTD_human_DG	8712863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	8712863	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bile Duct Diseases	Bile duct disease	Pubtator	14606706, 16038038	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	22206678		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	7519822	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	16038038		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12202941		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	31329860		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20953905		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	1691936, 20187292	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	2898508	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	3033649, 9020371		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37256932	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	7992839	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11459174, 2447190	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	29440406		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	37644056	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	40650227	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	1972610	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24130503		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	23450818		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	7537707	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10989646, 16321852, 29099772, 7519509		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	11953106		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	9817722		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	10086854, 8609252		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	20618958	Associate	★☆☆☆☆ Found in Text Mining only
clinical depression	Mental Depression	PSYGENET_DG	20516718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	7900941	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22083532	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29207960, 31625931		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22083532, 31625931	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	22206678		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	9576197		★☆☆☆☆ Found in Text Mining only
Congenital leukocyte adherence deficiency	Congenital Leukocyte Adherence Deficiency	BEFREE	21536861, 7901025		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12717693, 14695458	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	12717693	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	LHGDN	14695458		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	14695458	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	12139949		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28400196, 40650227, 7900941, 8537050	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20618958	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	24556642	Associate	★☆☆☆☆ Found in Text Mining only
Dental caries of smooth surface	Dental caries	GWASCAT_DG	24556642		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	9864003	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	1706746	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	1675200, 19995711	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28611472		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse Panbronchiolitis	BEFREE	9030883		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	9030883	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27906544		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	1348667, 23450818, 2842253	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23450818		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	27906544		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	11514959	Stimulate	★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	24487271		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	26370228	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	23583640	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	10643715	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	7775666		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	9551397	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	1370927	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	7900942	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	7680294, 9158103	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	28706510		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	28706510		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	11435733		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	31329860	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	1347281	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	7706478	Stimulate	★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	30136871		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31582539		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	31582539	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	11385505		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	25903419, 32938406	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29427909		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	3519653, 3528378		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24487271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	29958030		★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	21905501	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	9472661	Stimulate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	9472661	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20618153, 7935981		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23450818	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	1352710, 2137355	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	3048446	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	12855590, 23450818	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10706072, 10882733, 11264180, 23450818	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15108165	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11264180, 23450818, 7517211		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1356935, 9573029		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	10712675, 1671082, 1975779, 2464599, 2569026	Associate	★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	11714770	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	1968909, 24670684, 26434744, 27056660, 28445705, 7705401		★☆☆☆☆ Found in Text Mining only
Leukocyte Adhesion Deficiency Type III	Leukocyte adhesion deficiency	Pubtator	21536861, 3899217	Associate	★☆☆☆☆ Found in Text Mining only
Leukocyte Adhesion Deficiency Type III	Leukocyte adhesion deficiency	Pubtator	31329860	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukocyte Adhesion Deficiency, Type III	Leukocyte adhesion deficiency	BEFREE	11714770		★☆☆☆☆ Found in Text Mining only
Leukocyte Disorders	Leukocyte disorders	Pubtator	7662985	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	17036394	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	14606706, 16038038, 37844121, 7537707	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	23726040		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24189400, 26513172	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12115234, 18523434, 21192791, 28430662, 29066026		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12115234, 1376122, 18063917, 21192791, 24082908, 2438304, 25986394, 28430662	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23029299, 8254055	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33282947	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12115234, 18523434, 21192791, 28430662, 29066026		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12115234, 1376122, 18523434, 20131288, 20223637, 21192791, 21346232, 23340289, 2438304, 27283392, 28430662, 29066026		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12115234, 18523434, 21192791, 28430662, 29066026		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23583640	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	9949180		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	BEFREE	1546685		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	23450818	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28159748, 29099772, 29312326		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23039186, 8097520		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23039186, 30872676	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35865542	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	36906717	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11494147		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	1562732, 15741217, 17177159, 8103718, 8797890	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	1972610, 24430173	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	7507498		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15668954	Stimulate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12855590		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	23450818		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	23450818	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	23450818	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	23450818		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	15067196	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	9426029	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	24920725, 31627327		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	19353432, 9099932	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15356104, 19261694, 20953905, 22890882, 25701325, 29099772, 29207960, 29312326, 29464004, 29669928, 30258446, 31511625, 31582539, 7497527		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25197660	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36921085	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10531076	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10849374	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	11390487		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37800814	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	8093857	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29516510		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36148415	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16038038		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11385505, 22348003, 27191595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18029384	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35960497	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16907910	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34588774	Associate	★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	18775487		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	18775487		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28447099		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12643440, 27915349, 3263133		★☆☆☆☆ Found in Text Mining only
Sciatic Neuropathy	Sciatic Neuropathy	BEFREE	30961664		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	18029384	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24576991, 28714582		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	7748018	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	8652825	Stimulate	★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	26873628	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37210507	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36519208	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	1718289		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	23450818		★☆☆☆☆ Found in Text Mining only
TIBIAL MUSCULAR DYSTROPHY, TARDIVE	Tibial muscular dystrophy	BEFREE	23450818		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24982892	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	12139949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	1353063	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	30956760		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	9640196	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19995711	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	8254055	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	10086854	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	22083532	Associate	★☆☆☆☆ Found in Text Mining only