ITGAE (integrin subunit alpha E)

Gene

• Entrez ID: 3682
• Gene name: Integrin subunit alpha E
• Gene symbol: ITGAE
• Synonyms (NCBI Gene): CD103, HUMINAE
• Chromosome: 17
• Chromosome location: 17p13.2
• Summary: Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked h

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1073749	hsa-miR-129-5p	CLIP-seq
MIRT1073750	hsa-miR-1302	CLIP-seq
MIRT1073751	hsa-miR-1915	CLIP-seq
MIRT1073752	hsa-miR-193a-5p	CLIP-seq
MIRT1073753	hsa-miR-3122	CLIP-seq
MIRT1073754	hsa-miR-3691-3p	CLIP-seq
MIRT1073755	hsa-miR-3913-5p	CLIP-seq
MIRT1073756	hsa-miR-4298	CLIP-seq
MIRT1073757	hsa-miR-450b-5p	CLIP-seq
MIRT1073758	hsa-miR-4726-3p	CLIP-seq
MIRT1073759	hsa-miR-4731-5p	CLIP-seq
MIRT1073760	hsa-miR-507	CLIP-seq
MIRT1073761	hsa-miR-515-5p	CLIP-seq
MIRT1073762	hsa-miR-518a-5p	CLIP-seq
MIRT1073763	hsa-miR-527	CLIP-seq
MIRT1073764	hsa-miR-548ac	CLIP-seq
MIRT1073765	hsa-miR-548ae	CLIP-seq
MIRT1073766	hsa-miR-548aj	CLIP-seq
MIRT1073767	hsa-miR-548am	CLIP-seq
MIRT1073768	hsa-miR-548d-3p	CLIP-seq
MIRT1073769	hsa-miR-548x	CLIP-seq
MIRT1073770	hsa-miR-548z	CLIP-seq
MIRT1073771	hsa-miR-557	CLIP-seq
MIRT1073772	hsa-miR-584	CLIP-seq
MIRT1073749	hsa-miR-129-5p	CLIP-seq
MIRT1073757	hsa-miR-450b-5p	CLIP-seq
MIRT1073760	hsa-miR-507	CLIP-seq
MIRT1073771	hsa-miR-557	CLIP-seq
MIRT2553642	hsa-miR-1252	CLIP-seq
MIRT1073750	hsa-miR-1302	CLIP-seq
MIRT1073751	hsa-miR-1915	CLIP-seq
MIRT1073752	hsa-miR-193a-5p	CLIP-seq
MIRT2553643	hsa-miR-3064-5p	CLIP-seq
MIRT1073753	hsa-miR-3122	CLIP-seq
MIRT2553644	hsa-miR-3129-3p	CLIP-seq
MIRT2553645	hsa-miR-3140-5p	CLIP-seq
MIRT2553646	hsa-miR-3148	CLIP-seq
MIRT2553647	hsa-miR-3169	CLIP-seq
MIRT1073754	hsa-miR-3691-3p	CLIP-seq
MIRT1073755	hsa-miR-3913-5p	CLIP-seq
MIRT1073756	hsa-miR-4298	CLIP-seq
MIRT2553648	hsa-miR-4515	CLIP-seq
MIRT1073758	hsa-miR-4726-3p	CLIP-seq
MIRT1073759	hsa-miR-4731-5p	CLIP-seq
MIRT2553649	hsa-miR-4777-5p	CLIP-seq
MIRT2553650	hsa-miR-4793-5p	CLIP-seq
MIRT1073761	hsa-miR-515-5p	CLIP-seq
MIRT1073762	hsa-miR-518a-5p	CLIP-seq
MIRT1073763	hsa-miR-527	CLIP-seq
MIRT2553651	hsa-miR-548a-5p	CLIP-seq
MIRT2553652	hsa-miR-548ab	CLIP-seq
MIRT1073764	hsa-miR-548ac	CLIP-seq
MIRT1073765	hsa-miR-548ae	CLIP-seq
MIRT1073766	hsa-miR-548aj	CLIP-seq
MIRT2553653	hsa-miR-548ak	CLIP-seq
MIRT1073767	hsa-miR-548am	CLIP-seq
MIRT2553654	hsa-miR-548b-5p	CLIP-seq
MIRT2553655	hsa-miR-548c-5p	CLIP-seq
MIRT1073768	hsa-miR-548d-3p	CLIP-seq
MIRT2553656	hsa-miR-548d-5p	CLIP-seq
MIRT2553657	hsa-miR-548h	CLIP-seq
MIRT2553658	hsa-miR-548i	CLIP-seq
MIRT2553659	hsa-miR-548j	CLIP-seq
MIRT2553660	hsa-miR-548n	CLIP-seq
MIRT2553661	hsa-miR-548w	CLIP-seq
MIRT1073769	hsa-miR-548x	CLIP-seq
MIRT2553662	hsa-miR-548y	CLIP-seq
MIRT1073770	hsa-miR-548z	CLIP-seq
MIRT2553663	hsa-miR-559	CLIP-seq
MIRT1073772	hsa-miR-584	CLIP-seq
MIRT2553664	hsa-miR-892b	CLIP-seq
MIRT2553642	hsa-miR-1252	CLIP-seq
MIRT1073750	hsa-miR-1302	CLIP-seq
MIRT1073751	hsa-miR-1915	CLIP-seq
MIRT1073752	hsa-miR-193a-5p	CLIP-seq
MIRT2553643	hsa-miR-3064-5p	CLIP-seq
MIRT1073753	hsa-miR-3122	CLIP-seq
MIRT2553644	hsa-miR-3129-3p	CLIP-seq
MIRT2553645	hsa-miR-3140-5p	CLIP-seq
MIRT2553646	hsa-miR-3148	CLIP-seq
MIRT2553647	hsa-miR-3169	CLIP-seq
MIRT1073754	hsa-miR-3691-3p	CLIP-seq
MIRT1073755	hsa-miR-3913-5p	CLIP-seq
MIRT1073756	hsa-miR-4298	CLIP-seq
MIRT2553648	hsa-miR-4515	CLIP-seq
MIRT1073758	hsa-miR-4726-3p	CLIP-seq
MIRT1073759	hsa-miR-4731-5p	CLIP-seq
MIRT2553649	hsa-miR-4777-5p	CLIP-seq
MIRT2553650	hsa-miR-4793-5p	CLIP-seq
MIRT1073761	hsa-miR-515-5p	CLIP-seq
MIRT1073762	hsa-miR-518a-5p	CLIP-seq
MIRT1073763	hsa-miR-527	CLIP-seq
MIRT2553651	hsa-miR-548a-5p	CLIP-seq
MIRT2553652	hsa-miR-548ab	CLIP-seq
MIRT1073764	hsa-miR-548ac	CLIP-seq
MIRT1073765	hsa-miR-548ae	CLIP-seq
MIRT1073766	hsa-miR-548aj	CLIP-seq
MIRT2553653	hsa-miR-548ak	CLIP-seq
MIRT1073767	hsa-miR-548am	CLIP-seq
MIRT2553654	hsa-miR-548b-5p	CLIP-seq
MIRT2553655	hsa-miR-548c-5p	CLIP-seq
MIRT1073768	hsa-miR-548d-3p	CLIP-seq
MIRT2553656	hsa-miR-548d-5p	CLIP-seq
MIRT2553657	hsa-miR-548h	CLIP-seq
MIRT2553658	hsa-miR-548i	CLIP-seq
MIRT2553659	hsa-miR-548j	CLIP-seq
MIRT2553660	hsa-miR-548n	CLIP-seq
MIRT2553661	hsa-miR-548w	CLIP-seq
MIRT1073769	hsa-miR-548x	CLIP-seq
MIRT2553662	hsa-miR-548y	CLIP-seq
MIRT1073770	hsa-miR-548z	CLIP-seq
MIRT2553663	hsa-miR-559	CLIP-seq
MIRT1073772	hsa-miR-584	CLIP-seq
MIRT2553664	hsa-miR-892b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0008305	Component	Integrin complex	IBA
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	8119947
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IBA

Other IDs

• MIM: 604682
• HGNC: 6147
• e!Ensembl: ENSG00000083457

Protein

• UniProt ID: P38570
• Protein name: Integrin alpha-E (HML-1 antigen) (Integrin alpha-IEL) (Mucosal lymphocyte 1 antigen) (CD antigen CD103) [Cleaved into: Integrin alpha-E light chain; Integrin alpha-E heavy chain]
• Protein function: Integrin alpha-E/beta-7 is a receptor for E-cadherin. It mediates adhesion of intra-epithelial T-lymphocytes to epithelial cell monolayers.
• PDB: 8ZJF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00092	VWA	202 → 381	von Willebrand factor type A domain	Domain
  PF01839	FG-GAP	514 → 551	FG-GAP repeat	Repeat
  PF01839	FG-GAP	577 → 618	FG-GAP repeat	Repeat
  PF08441	Integrin_alpha2	676 → 965	Integrin alpha	Family
  PF00357	Integrin_alpha	1148 → 1162	Integrin alpha cytoplasmic region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells.
• Sequence:

  MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
  KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
  ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
  EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
  FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
  RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
  PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
  VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
  PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
  VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
  LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
  ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
  REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
  SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
  QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
  SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
  FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
  VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
  LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLI
  VILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN

• Sequence length: 1179

Pathways

KEGG:

Regulation of actin cytoskeleton

Reactome:

Integrin cell surface interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28099920, 30938449		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37949669	Stimulate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31471299		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28771609		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31644891		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12511714, 37271320	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28515363		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	40607400	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28771609		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	18839057		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASDB_DG	18839057		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31329981		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16426923, 28261866		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22509265		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	40607400	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21908444		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37488535	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26232338		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35793870	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34002666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38031731	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28099920, 33479027	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25957117		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	33654213, 34495570, 38430190	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28932636		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29361084, 31712385		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26080709, 26522261	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32513301	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36119930	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30100393, 31153587		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30100393, 36119930, 36792124, 36869093	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28733665		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	23022983		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30975145		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	14532999		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32513301	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	10673275		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26878989		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	32035984	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	28212742	Associate	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	37099426	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32471032, 36581331	Associate	★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	23022983, 8865850, 8921577		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	25725111, 26921343		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37864146	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30590794		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	32974219	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28109087		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37884280, 40498413	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28109087		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37096960	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31402273	Inhibit	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20417566		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	28261866, 28418282		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	30006565	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32527931	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	23504637	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26080709	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28316599, 30918941, 31582819		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	38430190	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	26878989		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34074699	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	14656893, 39391310	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	11079033, 21917686, 23347903, 24903677, 28418282, 29110361, 34710243, 37530550, 38440808, 8537498	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	10908151		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	10908151	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	12827664	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	LHGDN	18182176		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24477908, 26921343		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24477908, 33205076	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31329981		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31329981		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31329981		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31329981, 31402273		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	31402273	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31329981		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	10908151		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34166375	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	31692239		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	39547643	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25957117		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24477908, 31465302, 31771983		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22189006, 30674537		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36169985	Associate	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	31400196	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30288359		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	28212742, 36216310	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37949669	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	17897326	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	24905458		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24477908, 25957117, 28099920, 28412591, 28628092, 28932636, 29212947, 29343444, 30100393, 30288359, 30938449, 31771983		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37949669	Stimulate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25725111, 28099920, 30158938		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	35525376	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25957117		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27650547	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12434297, 9566785	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37949669	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontal Diseases	Periodontal disease	Pubtator	31677275	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31677275		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	31677275	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36759726	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28733665		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26878989, 27068801, 28927891		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12511714	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28557137		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28087652		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28087652, 31471299		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	10908151, 30585624	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	19604725		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	22537923	Inhibit	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	16316423, 34386009, 36881472	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26878989		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	25972487		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32527931, 35525376	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32205862, 33312758, 34767045, 35776160, 36119930	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19023099	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	20417566		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36420264	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26522261, 28700533		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12357319	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38091985, 39206965	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	28927891		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	28927891	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	28927891		★☆☆☆☆ Found in Text Mining only