ITGA9 (integrin subunit alpha 9)

Gene

• Entrez ID: 3680
• Gene name: Integrin subunit alpha 9
• Gene symbol: ITGA9
• Synonyms (NCBI Gene): ALPHA-RLC, ITGA4L, RLC
• Chromosome: 3
• Chromosome location: 3p22.2
• Summary: This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005895	hsa-miR-194-5p	Luciferase reporter assay, qRT-PCR, Western blot	20979124
MIRT041874	hsa-miR-484	CLASH	23622248
MIRT053450	hsa-miR-452-5p	Microarray	23807165
MIRT573157	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT573156	hsa-miR-4639-3p	PAR-CLIP	20371350
MIRT573155	hsa-miR-759	PAR-CLIP	20371350
MIRT573154	hsa-miR-519d-5p	PAR-CLIP	20371350
MIRT573153	hsa-miR-5695	PAR-CLIP	20371350
MIRT573152	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT573151	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT573150	hsa-miR-6794-3p	PAR-CLIP	20371350
MIRT573149	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT573148	hsa-miR-515-5p	PAR-CLIP	20371350
MIRT573147	hsa-miR-519e-5p	PAR-CLIP	20371350
MIRT736034	hsa-miR-148a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31489579
MIRT573157	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT573156	hsa-miR-4639-3p	PAR-CLIP	20371350
MIRT573155	hsa-miR-759	PAR-CLIP	20371350
MIRT573154	hsa-miR-519d-5p	PAR-CLIP	20371350
MIRT573153	hsa-miR-5695	PAR-CLIP	20371350
MIRT573152	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT573151	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT573150	hsa-miR-6794-3p	PAR-CLIP	20371350
MIRT573149	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT573148	hsa-miR-515-5p	PAR-CLIP	20371350
MIRT573147	hsa-miR-519e-5p	PAR-CLIP	20371350
MIRT1073725	hsa-miR-1202	CLIP-seq
MIRT1073726	hsa-miR-134	CLIP-seq
MIRT1073727	hsa-miR-194	CLIP-seq
MIRT1073728	hsa-miR-3118	CLIP-seq
MIRT1073729	hsa-miR-3163	CLIP-seq
MIRT1073730	hsa-miR-3164	CLIP-seq
MIRT1073731	hsa-miR-3165	CLIP-seq
MIRT1073732	hsa-miR-3194-5p	CLIP-seq
MIRT1073733	hsa-miR-331-5p	CLIP-seq
MIRT1073734	hsa-miR-340	CLIP-seq
MIRT1073735	hsa-miR-3607-5p	CLIP-seq
MIRT1073736	hsa-miR-369-5p	CLIP-seq
MIRT1073737	hsa-miR-3972	CLIP-seq
MIRT1073738	hsa-miR-4320	CLIP-seq
MIRT1073739	hsa-miR-4456	CLIP-seq
MIRT1073740	hsa-miR-4501	CLIP-seq
MIRT1073741	hsa-miR-548c-3p	CLIP-seq
MIRT1073742	hsa-miR-767-5p	CLIP-seq
MIRT2018206	hsa-miR-346	CLIP-seq
MIRT2018207	hsa-miR-4288	CLIP-seq
MIRT2018208	hsa-miR-632	CLIP-seq
MIRT2018209	hsa-miR-654-3p	CLIP-seq
MIRT2250087	hsa-miR-132	CLIP-seq
MIRT1073727	hsa-miR-194	CLIP-seq
MIRT2250088	hsa-miR-212	CLIP-seq
MIRT1073733	hsa-miR-331-5p	CLIP-seq
MIRT2250089	hsa-miR-4328	CLIP-seq
MIRT2250090	hsa-miR-4446-5p	CLIP-seq
MIRT2437973	hsa-miR-4659a-3p	CLIP-seq
MIRT2437974	hsa-miR-4659b-3p	CLIP-seq
MIRT2437975	hsa-miR-4666-5p	CLIP-seq
MIRT2437976	hsa-miR-664	CLIP-seq
MIRT1073726	hsa-miR-134	CLIP-seq
MIRT1073728	hsa-miR-3118	CLIP-seq
MIRT1073730	hsa-miR-3164	CLIP-seq
MIRT1073735	hsa-miR-3607-5p	CLIP-seq
MIRT2451994	hsa-miR-3650	CLIP-seq
MIRT2451995	hsa-miR-3688-5p	CLIP-seq
MIRT1073740	hsa-miR-4501	CLIP-seq
MIRT2451996	hsa-miR-4772-5p	CLIP-seq
MIRT2451997	hsa-miR-644	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MEIS1	Unknown	23139255
TBX5	Unknown	23139255

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	35802072
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IGI	21060781
GO:0007155	Process	Cell adhesion	TAS	8245132
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	19693543
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	8245132
GO:0009925	Component	Basal plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0034679	Component	Integrin alpha9-beta1 complex	IBA
GO:0034679	Component	Integrin alpha9-beta1 complex	IEA
GO:0034679	Component	Integrin alpha9-beta1 complex	IPI	25748048
GO:0034679	Component	Integrin alpha9-beta1 complex	ISS
GO:0038023	Function	Signaling receptor activity	IBA
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0045906	Process	Negative regulation of vasoconstriction	IMP	35802072
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	IEA
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	ISS

Other IDs

• MIM: 603963
• HGNC: 6145
• e!Ensembl: ENSG00000144668

Protein

• UniProt ID: Q13797
• Protein name: Integrin alpha-9 (Integrin alpha-RLC)
• Protein function: Integrin alpha-9/beta-1 (ITGA9:ITGB1) is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. ITGA9:ITGB1 may play a crucial role in SVEP1/polydom-mediated myoblast cell adhesion (By similar
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01839	FG-GAP	304 → 340	FG-GAP repeat	Repeat
  PF01839	FG-GAP	364 → 399	FG-GAP repeat	Repeat
  PF08441	Integrin_alpha2	459 → 909	Integrin alpha	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in vascular smooth muscle cells (at protein level) (PubMed:35802072). Expressed in the airway epithelium (at protein level) (PubMed:8245132). {ECO:0000269|PubMed:35802072, ECO:0000269|PubMed:8245132}.
• Sequence:

  MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
  RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
  DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
  EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIM
  NRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
  GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
  NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKIN
  PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
  QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMG
  QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
  RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALGAVKNISLNIS
  ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
  FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
  SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
  FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
  AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
  EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
  RKENEDSWDWVQKNQ

• Sequence length: 1035

Pathways

KEGG:

PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules
Regulation of actin cytoskeleton
Cytoskeleton in muscle cells
Human papillomavirus infection
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy

Reactome:

Integrin cell surface interactions
ECM proteoglycans
Signal transduction by L1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ITGA9-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	GWASCAT_DG	24529757		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1, AUTOSOMAL RECESSIVE	Amyotrophic lateral sclerosis	GWASCAT_DG	24529757		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder)	Amyotrophic lateral sclerosis	GWASCAT_DG	24529757		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	GWASCAT_DG	24529757		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29038247	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	23280964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23280964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21975548, 32420379, 33500458	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11156420		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23929437, 8290272		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30945681	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22491060, 23478628	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	31101927		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29595698	Associate	★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	19885927		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19885927		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18973153		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27866460		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28443617		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31678370		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31489579		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31489579		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37096960	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20412120	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23343568	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	19188145		★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops fetalis	Pubtator	36959127	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	36934253	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29951557		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31678370	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19140316		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	9179494	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	22529953	Associate	★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	19188145		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	23280964		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	23280964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	PSYGENET_DG	23280964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	23280964		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	23280964		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	8290272		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26491211, 28916657		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21071450, 21975548, 31008533, 31489579		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21975548		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	18794852		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26596831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	28443617		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	26596831		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19478819, 25180181, 26372814		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	19478819, 20512145		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26372814, 32985354	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	GWASCAT_DG	19478819		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19188145, 20412120, 21975548, 23478628, 26372814, 26491211, 27287342, 27866460, 29951557, 30449496, 31008533		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27287342		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	31678370		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26491211, 28916657		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26491211	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31678370		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29038247		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	28861129	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27287342		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20412120	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20412120		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31008533		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23478628	Associate	★☆☆☆☆ Found in Text Mining only