Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3678
Gene name	Integrin subunit alpha 5
Gene symbol	ITGA5
Synonyms (NCBI Gene)	CD49eFNRAVLA-5VLA5A
Chromosome	12
Chromosome location	12q13.13
Summary	The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is

280

Show/Hide all (280)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003031	hsa-miR-92a-3p	Luciferase reporter assayWestern blotMicroarray	19460962
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	19524507
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	19524507
MIRT007314	hsa-miR-148b-3p	Western blot	23238785
MIRT007314	hsa-miR-148b-3p	Western blot	23238785
MIRT007314	hsa-miR-148b-3p	Western blot	23238785
MIRT027753	hsa-miR-98-5p	Microarray	19088304
MIRT047079	hsa-miR-183-5p	CLASH	23622248
MIRT042174	hsa-miR-484	CLASH	23622248
MIRT036327	hsa-miR-1229-3p	CLASH	23622248
MIRT053040	hsa-miR-152-3p	Luciferase reporter assayqRT-PCRWestern blot	23238588
MIRT053480	hsa-miR-148a-3p	Luciferase reporter assayMicroarrayqRT-PCR	21703006
MIRT054779	hsa-miR-205-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24434435
MIRT007314	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007314	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007314	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT702642	hsa-miR-1295b-5p	HITS-CLIP	23313552
MIRT702641	hsa-miR-1912	HITS-CLIP	23313552
MIRT702640	hsa-miR-3130-5p	HITS-CLIP	23313552
MIRT702639	hsa-miR-4482-5p	HITS-CLIP	23313552
MIRT702638	hsa-miR-3065-3p	HITS-CLIP	23313552
MIRT702637	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT702636	hsa-miR-6887-3p	HITS-CLIP	23313552
MIRT702635	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT702634	hsa-miR-5585-5p	HITS-CLIP	23313552
MIRT702633	hsa-miR-6846-3p	HITS-CLIP	23313552
MIRT702632	hsa-miR-222-5p	HITS-CLIP	23313552
MIRT702631	hsa-miR-30a-3p	HITS-CLIP	23313552
MIRT702630	hsa-miR-30d-3p	HITS-CLIP	23313552
MIRT702629	hsa-miR-30e-3p	HITS-CLIP	23313552
MIRT731168	hsa-miR-26a-5p	Western blotLuciferase reporter assay	25537511
MIRT731168	hsa-miR-26a-5p	Western blotLuciferase reporter assay	25537511
MIRT004976	hsa-miR-31-5p	Luciferase reporter assay	27050274
MIRT004976	hsa-miR-31-5p	Luciferase reporter assay	27050274
MIRT731715	hsa-miR-17-3p	Luciferase reporter assayqRT-PCRWestern blot	27499367
MIRT731715	hsa-miR-17-3p	Luciferase reporter assayqRT-PCRWestern blot	27499367
MIRT731715	hsa-miR-17-3p	Luciferase reporter assayqRT-PCRWestern blot	27499367
MIRT731715	hsa-miR-17-3p	Luciferase reporter assayqRT-PCRWestern blot	27499367
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	26729197
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	26729197
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	26729197
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	26729197
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	26729197
MIRT004976	hsa-miR-31-5p	Luciferase reporter assayqRT-PCRWestern blot	26729197
MIRT733156	hsa-miR-210-3p	qRT-PCR	34135940
MIRT733158	hsa-miR-216a-5p	qRT-PCR	34101338
MIRT733163	hsa-miR-3677-3p	qRT-PCR	34101338
MIRT003031	hsa-miR-92a-3p	qRT-PCRWestern blotting	33742265
MIRT735591	hsa-miR-760	Western blottingImmunohistochemistry (IHC)qRT-PCR	32089706
MIRT702642	hsa-miR-1295b-5p	HITS-CLIP	23313552
MIRT702641	hsa-miR-1912	HITS-CLIP	23313552
MIRT702640	hsa-miR-3130-5p	HITS-CLIP	23313552
MIRT702639	hsa-miR-4482-5p	HITS-CLIP	23313552
MIRT702638	hsa-miR-3065-3p	HITS-CLIP	23313552
MIRT702637	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT702636	hsa-miR-6887-3p	HITS-CLIP	23313552
MIRT702635	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT702634	hsa-miR-5585-5p	HITS-CLIP	23313552
MIRT702633	hsa-miR-6846-3p	HITS-CLIP	23313552
MIRT702632	hsa-miR-222-5p	HITS-CLIP	23313552
MIRT702631	hsa-miR-30a-3p	HITS-CLIP	23313552
MIRT702630	hsa-miR-30d-3p	HITS-CLIP	23313552
MIRT702629	hsa-miR-30e-3p	HITS-CLIP	23313552
MIRT054779	hsa-miR-205-5p	MicroarrayqRT-PCR	35816043
MIRT1073592	hsa-miR-103a	CLIP-seq
MIRT1073593	hsa-miR-107	CLIP-seq
MIRT1073594	hsa-miR-1207-3p	CLIP-seq
MIRT1073595	hsa-miR-1207-5p	CLIP-seq
MIRT1073596	hsa-miR-1231	CLIP-seq
MIRT1073597	hsa-miR-1267	CLIP-seq
MIRT1073598	hsa-miR-128	CLIP-seq
MIRT1073599	hsa-miR-1301	CLIP-seq
MIRT1073600	hsa-miR-1343	CLIP-seq
MIRT1073601	hsa-miR-148a	CLIP-seq
MIRT1073602	hsa-miR-148b	CLIP-seq
MIRT1073603	hsa-miR-152	CLIP-seq
MIRT1073604	hsa-miR-199a-3p	CLIP-seq
MIRT1073605	hsa-miR-199b-3p	CLIP-seq
MIRT1073606	hsa-miR-205	CLIP-seq
MIRT1073607	hsa-miR-2681	CLIP-seq
MIRT1073608	hsa-miR-27a	CLIP-seq
MIRT1073609	hsa-miR-27b	CLIP-seq
MIRT1073610	hsa-miR-3127-3p	CLIP-seq
MIRT1073611	hsa-miR-3127-5p	CLIP-seq
MIRT1073612	hsa-miR-3129-5p	CLIP-seq
MIRT1073613	hsa-miR-3153	CLIP-seq
MIRT1073614	hsa-miR-3176	CLIP-seq
MIRT1073615	hsa-miR-3180-5p	CLIP-seq
MIRT1073616	hsa-miR-3184	CLIP-seq
MIRT1073617	hsa-miR-3665	CLIP-seq
MIRT1073618	hsa-miR-3922-3p	CLIP-seq
MIRT1073619	hsa-miR-3929	CLIP-seq
MIRT1073620	hsa-miR-3944-5p	CLIP-seq
MIRT1073621	hsa-miR-423-5p	CLIP-seq
MIRT1073622	hsa-miR-4419b	CLIP-seq
MIRT1073623	hsa-miR-4423-5p	CLIP-seq
MIRT1073624	hsa-miR-4435	CLIP-seq
MIRT1073625	hsa-miR-4447	CLIP-seq
MIRT1073626	hsa-miR-4472	CLIP-seq
MIRT1073627	hsa-miR-4478	CLIP-seq
MIRT1073628	hsa-miR-4487	CLIP-seq
MIRT1073629	hsa-miR-4514	CLIP-seq
MIRT1073630	hsa-miR-4520a-3p	CLIP-seq
MIRT1073631	hsa-miR-4633-3p	CLIP-seq
MIRT1073632	hsa-miR-4638-3p	CLIP-seq
MIRT1073633	hsa-miR-4646-5p	CLIP-seq
MIRT1073634	hsa-miR-4659a-5p	CLIP-seq
MIRT1073635	hsa-miR-4659b-5p	CLIP-seq
MIRT1073636	hsa-miR-4660	CLIP-seq
MIRT1073637	hsa-miR-4668-5p	CLIP-seq
MIRT1073638	hsa-miR-4688	CLIP-seq
MIRT1073639	hsa-miR-4692	CLIP-seq
MIRT1073640	hsa-miR-4711-5p	CLIP-seq
MIRT1073641	hsa-miR-4736	CLIP-seq
MIRT1073642	hsa-miR-4755-3p	CLIP-seq
MIRT1073643	hsa-miR-4763-3p	CLIP-seq
MIRT1073644	hsa-miR-4776-3p	CLIP-seq
MIRT1073645	hsa-miR-486-3p	CLIP-seq
MIRT1073646	hsa-miR-5047	CLIP-seq
MIRT1073647	hsa-miR-513a-5p	CLIP-seq
MIRT1073648	hsa-miR-520a-5p	CLIP-seq
MIRT1073649	hsa-miR-525-5p	CLIP-seq
MIRT1073650	hsa-miR-544	CLIP-seq
MIRT1073651	hsa-miR-657	CLIP-seq
MIRT1073652	hsa-miR-936	CLIP-seq
MIRT1073601	hsa-miR-148a	CLIP-seq
MIRT1073602	hsa-miR-148b	CLIP-seq
MIRT1073603	hsa-miR-152	CLIP-seq
MIRT1073617	hsa-miR-3665	CLIP-seq
MIRT1073628	hsa-miR-4487	CLIP-seq
MIRT1073630	hsa-miR-4520a-3p	CLIP-seq
MIRT1073631	hsa-miR-4633-3p	CLIP-seq
MIRT1073632	hsa-miR-4638-3p	CLIP-seq
MIRT1556581	hsa-miR-654-3p	CLIP-seq
MIRT1073651	hsa-miR-657	CLIP-seq
MIRT1073594	hsa-miR-1207-3p	CLIP-seq
MIRT1073595	hsa-miR-1207-5p	CLIP-seq
MIRT2018188	hsa-miR-1285	CLIP-seq
MIRT2018189	hsa-miR-1291	CLIP-seq
MIRT1073599	hsa-miR-1301	CLIP-seq
MIRT2018190	hsa-miR-28-5p	CLIP-seq
MIRT1073610	hsa-miR-3127-3p	CLIP-seq
MIRT1073611	hsa-miR-3127-5p	CLIP-seq
MIRT2018191	hsa-miR-3139	CLIP-seq
MIRT2018192	hsa-miR-3187-5p	CLIP-seq
MIRT736869	hsa-miR-326	CLIP-seq
MIRT2018193	hsa-miR-378g	CLIP-seq
MIRT2018194	hsa-miR-3920	CLIP-seq
MIRT2018195	hsa-miR-4486	CLIP-seq
MIRT1073628	hsa-miR-4487	CLIP-seq
MIRT1073629	hsa-miR-4514	CLIP-seq
MIRT1073631	hsa-miR-4633-3p	CLIP-seq
MIRT1073636	hsa-miR-4660	CLIP-seq
MIRT1073639	hsa-miR-4692	CLIP-seq
MIRT1073641	hsa-miR-4736	CLIP-seq
MIRT2018196	hsa-miR-4762-3p	CLIP-seq
MIRT1073643	hsa-miR-4763-3p	CLIP-seq
MIRT1073646	hsa-miR-5047	CLIP-seq
MIRT2018197	hsa-miR-612	CLIP-seq
MIRT2018198	hsa-miR-708	CLIP-seq
MIRT2018189	hsa-miR-1291	CLIP-seq
MIRT1073600	hsa-miR-1343	CLIP-seq
MIRT1073610	hsa-miR-3127-3p	CLIP-seq
MIRT1073611	hsa-miR-3127-5p	CLIP-seq
MIRT1073600	hsa-miR-1343	CLIP-seq
MIRT1073628	hsa-miR-4487	CLIP-seq
MIRT1073631	hsa-miR-4633-3p	CLIP-seq
MIRT2389487	hsa-miR-4761-5p	CLIP-seq
MIRT1073604	hsa-miR-199a-3p	CLIP-seq
MIRT1073605	hsa-miR-199b-3p	CLIP-seq
MIRT2018190	hsa-miR-28-5p	CLIP-seq
MIRT1073612	hsa-miR-3129-5p	CLIP-seq
MIRT2018191	hsa-miR-3139	CLIP-seq
MIRT2430133	hsa-miR-4287	CLIP-seq
MIRT2430134	hsa-miR-4292	CLIP-seq
MIRT2430135	hsa-miR-4308	CLIP-seq
MIRT2430136	hsa-miR-4469	CLIP-seq
MIRT2430137	hsa-miR-4482	CLIP-seq
MIRT2430138	hsa-miR-4685-3p	CLIP-seq
MIRT2430139	hsa-miR-4713-5p	CLIP-seq
MIRT2018198	hsa-miR-708	CLIP-seq
MIRT1073652	hsa-miR-936	CLIP-seq
MIRT1073598	hsa-miR-128	CLIP-seq
MIRT2018188	hsa-miR-1285	CLIP-seq
MIRT2018189	hsa-miR-1291	CLIP-seq
MIRT2437926	hsa-miR-1297	CLIP-seq
MIRT2437927	hsa-miR-1321	CLIP-seq
MIRT1073600	hsa-miR-1343	CLIP-seq
MIRT1073601	hsa-miR-148a	CLIP-seq
MIRT1073602	hsa-miR-148b	CLIP-seq
MIRT2437928	hsa-miR-149	CLIP-seq
MIRT1073603	hsa-miR-152	CLIP-seq
MIRT2437929	hsa-miR-1587	CLIP-seq
MIRT1073604	hsa-miR-199a-3p	CLIP-seq
MIRT1073605	hsa-miR-199b-3p	CLIP-seq
MIRT1073606	hsa-miR-205	CLIP-seq
MIRT2437930	hsa-miR-2110	CLIP-seq
MIRT2437931	hsa-miR-2355-5p	CLIP-seq
MIRT2437932	hsa-miR-26a	CLIP-seq
MIRT2437933	hsa-miR-26b	CLIP-seq
MIRT1073608	hsa-miR-27a	CLIP-seq
MIRT1073609	hsa-miR-27b	CLIP-seq
MIRT2018190	hsa-miR-28-5p	CLIP-seq
MIRT2437934	hsa-miR-2861	CLIP-seq
MIRT1073612	hsa-miR-3129-5p	CLIP-seq
MIRT2018191	hsa-miR-3139	CLIP-seq
MIRT2437935	hsa-miR-3150a-3p	CLIP-seq
MIRT2437936	hsa-miR-3175	CLIP-seq
MIRT1073614	hsa-miR-3176	CLIP-seq
MIRT2018192	hsa-miR-3187-5p	CLIP-seq
MIRT2437937	hsa-miR-3199	CLIP-seq
MIRT736869	hsa-miR-326	CLIP-seq
MIRT2437938	hsa-miR-328	CLIP-seq
MIRT2437939	hsa-miR-331-3p	CLIP-seq
MIRT2018193	hsa-miR-378g	CLIP-seq
MIRT1073618	hsa-miR-3922-3p	CLIP-seq
MIRT1073619	hsa-miR-3929	CLIP-seq
MIRT2437940	hsa-miR-4267	CLIP-seq
MIRT2437941	hsa-miR-4268	CLIP-seq
MIRT2437942	hsa-miR-4270	CLIP-seq
MIRT2437943	hsa-miR-4271	CLIP-seq
MIRT2430133	hsa-miR-4287	CLIP-seq
MIRT2430134	hsa-miR-4292	CLIP-seq
MIRT2437944	hsa-miR-4294	CLIP-seq
MIRT2430135	hsa-miR-4308	CLIP-seq
MIRT1073622	hsa-miR-4419b	CLIP-seq
MIRT2437945	hsa-miR-4441	CLIP-seq
MIRT1073625	hsa-miR-4447	CLIP-seq
MIRT2437946	hsa-miR-4465	CLIP-seq
MIRT2430136	hsa-miR-4469	CLIP-seq
MIRT1073626	hsa-miR-4472	CLIP-seq
MIRT1073627	hsa-miR-4478	CLIP-seq
MIRT2430137	hsa-miR-4482	CLIP-seq
MIRT2018195	hsa-miR-4486	CLIP-seq
MIRT2437947	hsa-miR-4492	CLIP-seq
MIRT2437948	hsa-miR-4498	CLIP-seq
MIRT2437949	hsa-miR-4505	CLIP-seq
MIRT2437950	hsa-miR-4512	CLIP-seq
MIRT2437951	hsa-miR-4515	CLIP-seq
MIRT2437952	hsa-miR-4652-5p	CLIP-seq
MIRT2437953	hsa-miR-4656	CLIP-seq
MIRT2437954	hsa-miR-4667-5p	CLIP-seq
MIRT2437955	hsa-miR-4675	CLIP-seq
MIRT2430138	hsa-miR-4685-3p	CLIP-seq
MIRT2437956	hsa-miR-4700-5p	CLIP-seq
MIRT2437957	hsa-miR-4711-3p	CLIP-seq
MIRT2437958	hsa-miR-4713-3p	CLIP-seq
MIRT2430139	hsa-miR-4713-5p	CLIP-seq
MIRT2437959	hsa-miR-4723-5p	CLIP-seq
MIRT2437960	hsa-miR-4725-3p	CLIP-seq
MIRT2437961	hsa-miR-4728-5p	CLIP-seq
MIRT2437962	hsa-miR-4731-5p	CLIP-seq
MIRT2437963	hsa-miR-4739	CLIP-seq
MIRT2437964	hsa-miR-4741	CLIP-seq
MIRT2437965	hsa-miR-4756-5p	CLIP-seq
MIRT2437966	hsa-miR-4766-5p	CLIP-seq
MIRT2437967	hsa-miR-4768-5p	CLIP-seq
MIRT1073647	hsa-miR-513a-5p	CLIP-seq
MIRT2437968	hsa-miR-593	CLIP-seq
MIRT2018197	hsa-miR-612	CLIP-seq
MIRT2437969	hsa-miR-637	CLIP-seq
MIRT1556581	hsa-miR-654-3p	CLIP-seq
MIRT2018198	hsa-miR-708	CLIP-seq
MIRT2437970	hsa-miR-762	CLIP-seq
MIRT2437971	hsa-miR-873	CLIP-seq
MIRT1073652	hsa-miR-936	CLIP-seq
MIRT2437972	hsa-miR-939	CLIP-seq
MIRT736869	hsa-miR-326	CLIP-seq
MIRT1073597	hsa-miR-1267	CLIP-seq
MIRT2437928	hsa-miR-149	CLIP-seq
MIRT2437931	hsa-miR-2355-5p	CLIP-seq
MIRT1073607	hsa-miR-2681	CLIP-seq
MIRT1073610	hsa-miR-3127-3p	CLIP-seq
MIRT2437939	hsa-miR-331-3p	CLIP-seq
MIRT2437940	hsa-miR-4267	CLIP-seq
MIRT2437941	hsa-miR-4268	CLIP-seq
MIRT1073623	hsa-miR-4423-5p	CLIP-seq
MIRT1073634	hsa-miR-4659a-5p	CLIP-seq
MIRT1073635	hsa-miR-4659b-5p	CLIP-seq
MIRT1073644	hsa-miR-4776-3p	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
HOXD3	Unknown	14610084
NFIC	Repression	18775869
PAX6	Unknown	10954416
SP1	Activation	18775869
ZEB2	Activation	22227038

Show/Hide all (82)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	TAS	19267251
GO:0001618	Function	Virus receptor activity	IEA
GO:0001704	Process	Formation of primary germ layer	IEA
GO:0001726	Component	Ruffle	TAS	11919189
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005161	Function	Platelet-derived growth factor receptor binding	TAS	19267251
GO:0005178	Function	Integrin binding	IEA
GO:0005509	Function	Calcium ion binding	IDA	33962943
GO:0005515	Function	Protein binding	IPI	12695522, 12724312, 12807887, 14970227, 16051604, 16099422, 17158881, 19141530, 19175293, 21947080, 22178926, 22451694, 22940691, 24011356, 30021884, 31331973, 33102950, 33961781, 33962943, 37184585
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	19141530
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	14970227
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA	14970227
GO:0005925	Component	Focal adhesion	IDA	17158881, 29162887
GO:0005925	Component	Focal adhesion	IEA
GO:0007044	Process	Cell-substrate junction assembly	IEA
GO:0007155	Process	Cell adhesion	IDA	19703720
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2454952
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	NAS	22451694
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	31331973
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	10022831
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	22451694
GO:0007565	Process	Female pregnancy	IEA
GO:0007613	Process	Memory	IEA
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	2454952
GO:0009888	Process	Tissue development	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	19581412, 23658023
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	17158881, 20563599, 23154389
GO:0009986	Component	Cell surface	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0014850	Process	Response to muscle activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0023035	Process	CD40 signaling pathway	IDA	31331973
GO:0030054	Component	Cell junction	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	TAS	19267251
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0031589	Process	Cell-substrate adhesion	IMP	19933311
GO:0032587	Component	Ruffle membrane	IDA	14970227
GO:0033627	Process	Cell adhesion mediated by integrin	IDA	12807887, 17158881
GO:0033627	Process	Cell adhesion mediated by integrin	IEA
GO:0033631	Process	Cell-cell adhesion mediated by integrin	IEA
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0034674	Component	Integrin alpha5-beta1 complex	IBA
GO:0034674	Component	Integrin alpha5-beta1 complex	IDA	31331973, 33102950
GO:0034674	Component	Integrin alpha5-beta1 complex	IPI	22451694
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEP	14970227
GO:0035313	Process	Wound healing, spreading of epidermal cells	NAS	22451694
GO:0035987	Process	Endodermal cell differentiation	IMP	23154389
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	TAS	19267251
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071062	Component	Alphav-beta3 integrin-vitronectin complex	TAS	19267251
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IMP	10022831
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	19460962
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356

MIM	HGNC	e!Ensembl
135620	6141	ENSG00000161638

P08648

Protein name

Integrin alpha-5 (CD49 antigen-like family member E) (Fibronectin receptor subunit alpha) (Integrin alpha-F) (VLA-5) (CD antigen CD49e) [Cleaved into: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain]

Protein function

Integrin alpha-5/beta-1 (ITGA5:ITGB1) is a receptor for fibronectin and fibrinogen. It recognizes the sequence R-G-D in its ligands. ITGA5:ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site

PDB

3VI3 , 3VI4 , 4WJK , 4WK0 , 4WK2 , 4WK4 , 7NWL , 7NXD , 9B9J , 9B9K , 9CKV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01839	FG-GAP	326 → 368	FG-GAP repeat	Repeat
PF01839	FG-GAP	392 → 428	FG-GAP repeat	Repeat
PF08441	Integrin_alpha2	489 → 921	Integrin alpha	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta (at protein level). {ECO:0000269|PubMed:33962943}.

Sequence

MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRL
LESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLST
DNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ
IAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQ
EVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFG
VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI
GFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVF
GEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDY
FAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVV
SFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRS
SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAV
YKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYIL
YKLGFFKRSLPYGTAMEKAQLKPPATSDA

Sequence length

1049

Interactions

View interactions

	KEGG		Reactome
	Virion - Herpesvirus Phagosome PI3K-Akt signaling pathway Focal adhesion ECM-receptor interaction Hematopoietic cell lineage Regulation of actin cytoskeleton Cytoskeleton in muscle cells Bacterial invasion of epithelial cells Shigellosis Pertussis Yersinia infection Human papillomavirus infection Herpes simplex virus 1 infection Proteoglycans in cancer MicroRNAs in cancer Hypertrophic cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy Dilated cardiomyopathy		Elastic fibre formation Fibronectin matrix formation Cell surface interactions at the vascular wall Integrin cell surface interactions Signal transduction by L1 RUNX2 regulates genes involved in cell migration

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (150)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	31600854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11911248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38160360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	LHGDN	17498594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	15994925		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31517053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11854734	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22797469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	32851057, 39991758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	11854734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29382667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1376652, 18361097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29382667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	23465222		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24079479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12350512, 31298367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22072592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11172040, 20530680, 20540537, 20564209, 21838876, 23233531, 27317874, 28213554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20332114, 21838876, 23233531, 29498809, 33420367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17363590, 24747441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33215860, 33399102, 35345355, 35414782, 35946175, 36212175, 36246403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35982891	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12350512, 31298367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15756594, 24434435, 24488787, 25370835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24862756, 25092917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34659450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	8562338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23499550, 23640055, 23725446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	17505007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	9741315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30172921		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21239458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21239458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11911248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17965775, 31322253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18835580, 7539800, 8612688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11169447, 31322253, 9430710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15757908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11299820, 25600770, 26873488, 27633518, 28356422, 29274284, 31202709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15757908, 24687888, 26175278, 26873488, 32305992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36405728	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24862756, 25092917, 25623744, 29296184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24455749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19171333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31682765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36290884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29855729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	7650060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28689917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	9137089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	33711961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	25041566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12881526, 15994925, 22072592, 22472177, 23704872, 28336765, 28619756, 29603594, 29882028, 8939197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28336765, 30497369, 30894197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12881526, 15994925, 22072592, 22472177, 25853691, 28336765, 29603594, 8939197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17145879, 19033423, 23403076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18464290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30894197, 37096960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	7900942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35090306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	7682756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	20007695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	7706478	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	33420367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	17786296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15026807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35946175	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28629363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28629363	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	12397091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	7682756	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11399509, 37536029, 7678062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15183897, 23233446, 23686445, 30484958, 37536029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23686445, 29342970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10888226, 18694400, 19036703, 24079479, 24333181, 27145276, 28094803, 29453316, 30215728, 31142737, 31221997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10607488	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17482311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22266541, 24434435, 8080732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36193075	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11172040, 20530680, 20540537, 20564209, 21127199, 21838876, 23233531, 27317874, 28213554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24434435, 24488787, 25370835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23499550, 23640055, 23725446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26846197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23559257, 23984644, 31319863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	17786296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26729197, 28560594, 30002985, 30568862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	20528248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12350512, 31298367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11778901, 17952617, 20102181, 22227038, 23000157, 23499550, 23640055, 24434435, 24440971, 24723437, 26846197, 27590631, 30710055, 30909080, 31202709, 31600854, 9614556 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21239458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18835580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21343398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	12213704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11911248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25736470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11291042, 11553709, 11778901, 12198771, 1376331, 16631740, 17363590, 21239882, 22773839, 8806594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	Pubtator	24083598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10029595, 10233376, 11380472, 7780154, 8329711, 8490175, 8797890, 9359513, 9575147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20528248, 24356728, 8329711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27734595	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	20382434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	20382434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30484958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24440971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11291042, 12198771, 15994925, 16391197, 18835580, 19296102, 19320477, 19541645, 19998373, 20052508, 20528248, 20540537, 22248086, 22692860, 24079479 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28867147, 9137089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	7682756	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22692860, 24434435, 25370835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24455749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32964955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28823917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	28806779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23640055		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17624082		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23499550, 23725446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23443083, 28328815, 32434219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26846197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19825166, 40443671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26749005, 30449496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31439856		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27186070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	21116829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	20332668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23559257, 23984644, 31319863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15500293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23984644, 27590631, 36749798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29380900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24862756, 25623744, 28363829, 29296184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28483378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28376277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11721465, 16301681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	37179440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12009335, 25190218, 25497015, 30909080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15331608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21401805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29719198, 31562292, 32623386, 34917682, 34994984, 36425786, 36438491, 37371537, 38420803, 39375732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33099569	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31579416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19581046, 26729197, 28560594, 30002985, 30568862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	17786296		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	25884934, 26729197, 33711961, 36193075, 36631800, 36765401, 37823316	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	30873760	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	38067435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11721465, 16301681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21127199, 29964204, 30352320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32495883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30908730, 35090306, 36969161, 36999964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	21150164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26648324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	14551535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ITGA5 (integrin subunit alpha 5)