IRF7 (interferon regulatory factor 7)

Gene

• Entrez ID: 3665
• Gene name: Interferon regulatory factor 7
• Gene symbol: IRF7
• Synonyms (NCBI Gene): IMD39, IRF-7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain g

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs375323253	G>A	Pathogenic	Stop gained, coding sequence variant
rs786205223	A>C	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021215	hsa-miR-146a-5p	Microarray	18057241
MIRT736401	hsa-miR-369-3p	qRT-PCR, Flow cytometry	33679688
MIRT736425	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Repression	21148039
BRCA1	Activation	17374731
IRF3	Unknown	20483755
KAT2B	Repression	12374802
NFKB1	Activation	15265881;16982926
NFKB1	Unknown	11877397
PITX1	Repression	12242290
RELA	Activation	15265881;16982926
RELA	Unknown	11877397
SPIB	Repression	22698399
STAT1	Activation	16628196
TNFAIP3	Repression	20392859
YY1	Unknown	22065573

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	9315633
GO:0000785	Component	Chromatin	IDA	11473119
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17404045
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	17404045
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0002376	Process	Immune system process	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	21931555
GO:0002819	Process	Regulation of adaptive immune response	IDA	17404045
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	12374802
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11943871, 17599067, 18922877, 19017798, 19176627, 20392859, 21903422, 30833792
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22065573
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9786932
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	19176627
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IGI	23729669
GO:0005737	Component	Cytoplasm	TAS	9786932
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006974	Process	DNA damage response	TAS	16979567
GO:0007165	Process	Signal transduction	IEA
GO:0009615	Process	Response to virus	TAS	9786932, 21490621
GO:0010008	Component	Endosome membrane	TAS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0019043	Process	Establishment of viral latency	TAS	21490621
GO:0032479	Process	Regulation of type I interferon production	TAS	21490621
GO:0032481	Process	Positive regulation of type I interferon production	IDA	17404045
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16127453
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	TAS	16979567
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	22065573
GO:0032728	Process	Positive regulation of interferon-beta production	TAS	16979567
GO:0034124	Process	Regulation of MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0034124	Process	Regulation of MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0034127	Process	Regulation of MyD88-independent toll-like receptor signaling pathway	IEA
GO:0034127	Process	Regulation of MyD88-independent toll-like receptor signaling pathway	ISS
GO:0039530	Process	MDA-5 signaling pathway	TAS	16979567
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	TAS	17404045
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045655	Process	Regulation of monocyte differentiation	TAS	21490621
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	12374802
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453, 17404045
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050776	Process	Regulation of immune response	TAS	21490621
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IEA
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000110	Process	Negative regulation of macrophage apoptotic process	TAS	21490621

Other IDs

• MIM: 605047
• HGNC: 6122
• e!Ensembl: ENSG00000185507

Protein

• UniProt ID: Q92985
• Protein name: Interferon regulatory factor 7 (IRF-7)
• Protein function: Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses (PubMed:28342865, PubMed:28768858). Regulates the transcription of type I IFN
• PDB: 2O61
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00605	IRF	13 → 125	Interferon regulatory factor transcription factor	Domain
  PF10401	IRF-3	287 → 466	Interferon-regulatory factor 3	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in spleen, thymus and peripheral blood leukocytes.
• Sequence:

  MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
  KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
  VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
  DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
  ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
  LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
  LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
  QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
  CLSSANSLYDDIECFLMELEQPA

• Sequence length: 503

Pathways

KEGG:

Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Viral carcinogenesis
Lipid and atherosclerosis

Reactome:

DEx/H-box helicases activate type I IFN and inflammatory cytokines production
Interferon gamma signaling
TICAM1-dependent activation of IRF3/IRF7
Interferon alpha/beta signaling
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 39	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity; risk factor	ClinVar ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
IMMUNODEFICIENCY 39, SUSCEPTIBILITY TO VIRAL INFECTIONS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRF7-related disorder	Likely benign; Uncertain significance; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25476905		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32046242, 38257800	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	25809693	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22112518, 31775040	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29411555, 31775040		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31775040	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15367334		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21926187, 25911105		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26794091, 27630164	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	29909011		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22434214		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22820642, 30546090		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26597380	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	28712115		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10924517, 21199806	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17508019	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37209778	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22194884		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31170225		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26133168, 33161410	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25350395, 25546690		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25350395, 25546690, 31869529	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34488791	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24120739		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	29909011		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19877033, 33576578	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	21670437		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29894743		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29894743		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34076249	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23386205	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36527108	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	20827270, 23386205, 23490285		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30094631		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	37097753	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35993041	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	24726644		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24997224		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30739198		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	30739198	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30886199		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30886199, 35035811	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25680411		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25680411	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25680411, 28243325		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22434214, 25680411		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25680411, 33902005	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	31494956		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	24997224	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	37209778	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	35977101	Associate	★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 39	Immunodeficiency	UNIPROT_DG	25814066		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
IMMUNODEFICIENCY 39	Immunodeficiency	GENOMICS_ENGLAND_DG	9315633		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
IMMUNODEFICIENCY 39	Immunodeficiency	CLINVAR_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
IMMUNODEFICIENCY 39	Immunodeficiency	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19706707, 27864558		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	14668346, 17522209		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	22433914	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25476905	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	32763828	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25476905		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	21199806		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19858727		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18397234		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30772497		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22194884	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21576205, 21632682, 26005050		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	36212172	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	33879674, 36212172	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20112359, 21360504, 22433914, 26005050, 29257335, 29437559, 31790472, 33108347, 35710306	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35757684	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21576205, 21632682, 26005050		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20112359, 21167895, 21360504, 21575916, 21576205, 21632682, 21872684, 21926187, 22433914, 22455868, 26005050, 27159270		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	27399966, 28714469		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21576205, 21632682, 26005050		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11884566, 17393359	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17393359		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28712115		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17393359	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22832429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22832429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	22820642, 30546090		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22194884		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	28712115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27733217		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22434214, 28092673, 28243325, 28712115		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28560754		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	23690996, 28569178	Associate	★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	31440254	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16077073	Associate	★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	29570417		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28712115		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22820642, 25108500, 25300801, 27733217, 28651122, 30546090		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30278439		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24997224		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31488196		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27353415	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35012444	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27733217		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20395558, 31170225	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35558069	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent pyelonephritis	Pyelonephritis	BEFREE	27122612		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	25569146	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28569041		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848, 30446998, 37614232	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24162015		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20507321	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21926187, 28952189, 31439591		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	25476905		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	22832429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	34670303	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	20154210	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30639243		★☆☆☆☆ Found in Text Mining only