IRF4 (interferon regulatory factor 4)

Gene

• Entrez ID: 3662
• Gene name: Interferon regulatory factor 4
• Gene symbol: IRF4
• Synonyms (NCBI Gene): IMD131, LSIRF, MUM1, NF-EM5, SHEP8
• Chromosome: 6
• Chromosome location: 6p25.3
• Summary: The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs12203592	C>T	Affects	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004534	hsa-miR-125b-5p	qRT-PCR, Luciferase reporter assay	20497960
MIRT504380	hsa-miR-574-3p	HITS-CLIP	21572407
MIRT504379	hsa-miR-3943	HITS-CLIP	21572407
MIRT504378	hsa-miR-1324	HITS-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	HITS-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	HITS-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	HITS-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	HITS-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	HITS-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT504379	hsa-miR-3943	PAR-CLIP	20371350
MIRT504378	hsa-miR-1324	PAR-CLIP	20371350
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	20371350
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	20371350
MIRT169110	hsa-miR-4319	PAR-CLIP	20371350
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	20371350
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	20371350
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT504373	hsa-miR-4313	PAR-CLIP	20371350
MIRT504380	hsa-miR-574-3p	PAR-CLIP	21572407
MIRT504379	hsa-miR-3943	PAR-CLIP	21572407
MIRT504378	hsa-miR-1324	PAR-CLIP	21572407
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	21572407
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	21572407
MIRT169110	hsa-miR-4319	PAR-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT497330	hsa-miR-497-3p	PAR-CLIP	22291592
MIRT497329	hsa-miR-4678	PAR-CLIP	22291592
MIRT169035	hsa-miR-6792-5p	PAR-CLIP	22291592
MIRT218949	hsa-miR-331-5p	PAR-CLIP	22291592
MIRT401842	hsa-miR-4503	PAR-CLIP	22291592
MIRT169058	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT169067	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT169059	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT169070	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT168937	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT168938	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT004534	hsa-miR-125b-5p	qRT-PCR	27903272
MIRT735049	hsa-miR-155-5p	Microarray	32990751
MIRT504380	hsa-miR-574-3p	HITS-CLIP	21572407
MIRT504379	hsa-miR-3943	HITS-CLIP	21572407
MIRT504378	hsa-miR-1324	HITS-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	HITS-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	HITS-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	HITS-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	HITS-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	HITS-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT504379	hsa-miR-3943	PAR-CLIP	20371350
MIRT504378	hsa-miR-1324	PAR-CLIP	20371350
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	20371350
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	20371350
MIRT169110	hsa-miR-4319	PAR-CLIP	20371350
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	20371350
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	20371350
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT504373	hsa-miR-4313	PAR-CLIP	20371350
MIRT504380	hsa-miR-574-3p	PAR-CLIP	21572407
MIRT504379	hsa-miR-3943	PAR-CLIP	21572407
MIRT504378	hsa-miR-1324	PAR-CLIP	21572407
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	21572407
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	21572407
MIRT169110	hsa-miR-4319	PAR-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT497330	hsa-miR-497-3p	PAR-CLIP	22291592
MIRT497329	hsa-miR-4678	PAR-CLIP	22291592
MIRT169035	hsa-miR-6792-5p	PAR-CLIP	22291592
MIRT218949	hsa-miR-331-5p	PAR-CLIP	22291592
MIRT401842	hsa-miR-4503	PAR-CLIP	22291592
MIRT1071207	hsa-miR-103a	CLIP-seq
MIRT1071208	hsa-miR-107	CLIP-seq
MIRT1071209	hsa-miR-1228	CLIP-seq
MIRT1071210	hsa-miR-1262	CLIP-seq
MIRT1071211	hsa-miR-127-5p	CLIP-seq
MIRT1071212	hsa-miR-1293	CLIP-seq
MIRT1071213	hsa-miR-1298	CLIP-seq
MIRT1071214	hsa-miR-15a	CLIP-seq
MIRT1071215	hsa-miR-15b	CLIP-seq
MIRT1071216	hsa-miR-16	CLIP-seq
MIRT1071217	hsa-miR-195	CLIP-seq
MIRT1071218	hsa-miR-24	CLIP-seq
MIRT1071219	hsa-miR-3122	CLIP-seq
MIRT1071220	hsa-miR-3130-5p	CLIP-seq
MIRT1071221	hsa-miR-3160-3p	CLIP-seq
MIRT1071222	hsa-miR-3171	CLIP-seq
MIRT1071223	hsa-miR-342-3p	CLIP-seq
MIRT1071224	hsa-miR-3682-5p	CLIP-seq
MIRT1071225	hsa-miR-3689d	CLIP-seq
MIRT1071226	hsa-miR-3913-5p	CLIP-seq
MIRT1071227	hsa-miR-424	CLIP-seq
MIRT1071228	hsa-miR-4264	CLIP-seq
MIRT1071229	hsa-miR-4284	CLIP-seq
MIRT1071230	hsa-miR-4320	CLIP-seq
MIRT1071231	hsa-miR-4328	CLIP-seq
MIRT1071232	hsa-miR-433	CLIP-seq
MIRT1071233	hsa-miR-4422	CLIP-seq
MIRT1071234	hsa-miR-4482	CLIP-seq
MIRT1071235	hsa-miR-4483	CLIP-seq
MIRT1071236	hsa-miR-4487	CLIP-seq
MIRT1071237	hsa-miR-450b-3p	CLIP-seq
MIRT1071238	hsa-miR-4520a-3p	CLIP-seq
MIRT1071239	hsa-miR-4638-3p	CLIP-seq
MIRT1071240	hsa-miR-4681	CLIP-seq
MIRT1071241	hsa-miR-4701-3p	CLIP-seq
MIRT1071242	hsa-miR-4760-3p	CLIP-seq
MIRT1071243	hsa-miR-4797-3p	CLIP-seq
MIRT1071244	hsa-miR-4803	CLIP-seq
MIRT1071245	hsa-miR-495	CLIP-seq
MIRT1071246	hsa-miR-497	CLIP-seq
MIRT1071247	hsa-miR-513a-3p	CLIP-seq
MIRT1071248	hsa-miR-548a-3p	CLIP-seq
MIRT1071249	hsa-miR-548ae	CLIP-seq
MIRT1071250	hsa-miR-548aj	CLIP-seq
MIRT1071251	hsa-miR-548am	CLIP-seq
MIRT1071252	hsa-miR-548c-3p	CLIP-seq
MIRT1071253	hsa-miR-548e	CLIP-seq
MIRT1071254	hsa-miR-548f	CLIP-seq
MIRT1071255	hsa-miR-548x	CLIP-seq
MIRT1071256	hsa-miR-558	CLIP-seq
MIRT1071257	hsa-miR-587	CLIP-seq
MIRT1071258	hsa-miR-592	CLIP-seq
MIRT1071259	hsa-miR-597	CLIP-seq
MIRT1071260	hsa-miR-599	CLIP-seq
MIRT1071261	hsa-miR-602	CLIP-seq
MIRT1071262	hsa-miR-668	CLIP-seq
MIRT1071263	hsa-miR-769-3p	CLIP-seq
MIRT1071264	hsa-miR-9	CLIP-seq
MIRT1071265	hsa-miR-1270	CLIP-seq
MIRT1071266	hsa-miR-1305	CLIP-seq
MIRT1071267	hsa-miR-2116	CLIP-seq
MIRT1071268	hsa-miR-300	CLIP-seq
MIRT1071219	hsa-miR-3122	CLIP-seq
MIRT1071269	hsa-miR-3124-3p	CLIP-seq
MIRT1071270	hsa-miR-3192	CLIP-seq
MIRT1071271	hsa-miR-3611	CLIP-seq
MIRT1071272	hsa-miR-3653	CLIP-seq
MIRT1071273	hsa-miR-3658	CLIP-seq
MIRT1071274	hsa-miR-3685	CLIP-seq
MIRT1071225	hsa-miR-3689d	CLIP-seq
MIRT1071275	hsa-miR-376c	CLIP-seq
MIRT1071276	hsa-miR-381	CLIP-seq
MIRT1071277	hsa-miR-384	CLIP-seq
MIRT1071226	hsa-miR-3913-5p	CLIP-seq
MIRT1071278	hsa-miR-4271	CLIP-seq
MIRT1071279	hsa-miR-4277	CLIP-seq
MIRT1071280	hsa-miR-432	CLIP-seq
MIRT1071230	hsa-miR-4320	CLIP-seq
MIRT1071281	hsa-miR-4434	CLIP-seq
MIRT1071282	hsa-miR-4495	CLIP-seq
MIRT1071283	hsa-miR-4496	CLIP-seq
MIRT1071237	hsa-miR-450b-3p	CLIP-seq
MIRT1071284	hsa-miR-4516	CLIP-seq
MIRT1071285	hsa-miR-4531	CLIP-seq
MIRT1071286	hsa-miR-4643	CLIP-seq
MIRT1071287	hsa-miR-466	CLIP-seq
MIRT1071288	hsa-miR-4662a-3p	CLIP-seq
MIRT1071289	hsa-miR-4666-3p	CLIP-seq
MIRT1071290	hsa-miR-4709-3p	CLIP-seq
MIRT1071291	hsa-miR-4716-3p	CLIP-seq
MIRT1071292	hsa-miR-4725-3p	CLIP-seq
MIRT1071293	hsa-miR-4728-3p	CLIP-seq
MIRT1071294	hsa-miR-4789-3p	CLIP-seq
MIRT1071295	hsa-miR-4793-3p	CLIP-seq
MIRT1071296	hsa-miR-4795-5p	CLIP-seq
MIRT1071297	hsa-miR-4800-5p	CLIP-seq
MIRT1071298	hsa-miR-501-3p	CLIP-seq
MIRT1071299	hsa-miR-501-5p	CLIP-seq
MIRT1071300	hsa-miR-502-3p	CLIP-seq
MIRT1071301	hsa-miR-508-5p	CLIP-seq
MIRT1071302	hsa-miR-576-3p	CLIP-seq
MIRT1071258	hsa-miR-592	CLIP-seq
MIRT1071259	hsa-miR-597	CLIP-seq
MIRT1071260	hsa-miR-599	CLIP-seq
MIRT1071303	hsa-miR-607	CLIP-seq
MIRT1071304	hsa-miR-620	CLIP-seq
MIRT1071305	hsa-miR-625	CLIP-seq
MIRT1071306	hsa-miR-642b	CLIP-seq
MIRT1071307	hsa-miR-661	CLIP-seq
MIRT1071262	hsa-miR-668	CLIP-seq
MIRT1071308	hsa-miR-711	CLIP-seq
MIRT1071309	hsa-miR-758	CLIP-seq
MIRT1071310	hsa-miR-766	CLIP-seq
MIRT1071263	hsa-miR-769-3p	CLIP-seq
MIRT1071311	hsa-miR-889	CLIP-seq
MIRT1071264	hsa-miR-9	CLIP-seq
MIRT2017523	hsa-miR-128	CLIP-seq
MIRT2017524	hsa-miR-214	CLIP-seq
MIRT2017525	hsa-miR-27a	CLIP-seq
MIRT2017526	hsa-miR-27b	CLIP-seq
MIRT2017527	hsa-miR-3120-3p	CLIP-seq
MIRT2017528	hsa-miR-3148	CLIP-seq
MIRT2017529	hsa-miR-3614-5p	CLIP-seq
MIRT2017530	hsa-miR-3619-5p	CLIP-seq
MIRT2017531	hsa-miR-4274	CLIP-seq
MIRT2017532	hsa-miR-4428	CLIP-seq
MIRT2017533	hsa-miR-4436b-5p	CLIP-seq
MIRT2017534	hsa-miR-4778-3p	CLIP-seq
MIRT2017535	hsa-miR-513a-5p	CLIP-seq
MIRT2017536	hsa-miR-579	CLIP-seq
MIRT2017537	hsa-miR-761	CLIP-seq
MIRT2249460	hsa-miR-1208	CLIP-seq
MIRT2017523	hsa-miR-128	CLIP-seq
MIRT2249461	hsa-miR-1321	CLIP-seq
MIRT2249462	hsa-miR-1323	CLIP-seq
MIRT2249463	hsa-miR-145	CLIP-seq
MIRT2249464	hsa-miR-1587	CLIP-seq
MIRT2249465	hsa-miR-1825	CLIP-seq
MIRT2249466	hsa-miR-1827	CLIP-seq
MIRT2249467	hsa-miR-199a-5p	CLIP-seq
MIRT2249468	hsa-miR-199b-5p	CLIP-seq
MIRT2249469	hsa-miR-204	CLIP-seq
MIRT2249470	hsa-miR-211	CLIP-seq
MIRT2249471	hsa-miR-2115	CLIP-seq
MIRT2017525	hsa-miR-27a	CLIP-seq
MIRT2017526	hsa-miR-27b	CLIP-seq
MIRT2017528	hsa-miR-3148	CLIP-seq
MIRT2249472	hsa-miR-3153	CLIP-seq
MIRT1071221	hsa-miR-3160-3p	CLIP-seq
MIRT2249473	hsa-miR-3180-5p	CLIP-seq
MIRT2249474	hsa-miR-3616-3p	CLIP-seq
MIRT2249475	hsa-miR-3647-3p	CLIP-seq
MIRT2249476	hsa-miR-3671	CLIP-seq
MIRT2249477	hsa-miR-370	CLIP-seq
MIRT2249478	hsa-miR-371b-5p	CLIP-seq
MIRT2249479	hsa-miR-3929	CLIP-seq
MIRT2249480	hsa-miR-4270	CLIP-seq
MIRT2249481	hsa-miR-4324	CLIP-seq
MIRT2249482	hsa-miR-4419b	CLIP-seq
MIRT1071233	hsa-miR-4422	CLIP-seq
MIRT2017532	hsa-miR-4428	CLIP-seq
MIRT2249483	hsa-miR-4436b-3p	CLIP-seq
MIRT2249484	hsa-miR-4441	CLIP-seq
MIRT2249485	hsa-miR-4459	CLIP-seq
MIRT2249486	hsa-miR-4478	CLIP-seq
MIRT1071236	hsa-miR-4487	CLIP-seq
MIRT2249487	hsa-miR-4492	CLIP-seq
MIRT2249488	hsa-miR-4498	CLIP-seq
MIRT2249489	hsa-miR-4505	CLIP-seq
MIRT2249490	hsa-miR-4635	CLIP-seq
MIRT2249491	hsa-miR-4646-5p	CLIP-seq
MIRT2249492	hsa-miR-4649-3p	CLIP-seq
MIRT2249493	hsa-miR-4656	CLIP-seq
MIRT2249494	hsa-miR-4668-5p	CLIP-seq
MIRT2249495	hsa-miR-4674	CLIP-seq
MIRT2249496	hsa-miR-4675	CLIP-seq
MIRT2249497	hsa-miR-4695-5p	CLIP-seq
MIRT2249498	hsa-miR-4699-3p	CLIP-seq
MIRT2249499	hsa-miR-4722-5p	CLIP-seq
MIRT2249500	hsa-miR-4739	CLIP-seq
MIRT2249501	hsa-miR-4741	CLIP-seq
MIRT2249502	hsa-miR-4755-5p	CLIP-seq
MIRT2249503	hsa-miR-4756-5p	CLIP-seq
MIRT2249504	hsa-miR-4768-3p	CLIP-seq
MIRT1071295	hsa-miR-4793-3p	CLIP-seq
MIRT2249505	hsa-miR-4793-5p	CLIP-seq
MIRT2249506	hsa-miR-485-5p	CLIP-seq
MIRT1071301	hsa-miR-508-5p	CLIP-seq
MIRT1071247	hsa-miR-513a-3p	CLIP-seq
MIRT2249507	hsa-miR-516a-3p	CLIP-seq
MIRT2249508	hsa-miR-520a-5p	CLIP-seq
MIRT2249509	hsa-miR-525-5p	CLIP-seq
MIRT2249510	hsa-miR-541	CLIP-seq
MIRT2249511	hsa-miR-548an	CLIP-seq
MIRT2249512	hsa-miR-548o	CLIP-seq
MIRT1071256	hsa-miR-558	CLIP-seq
MIRT2249513	hsa-miR-590-3p	CLIP-seq
MIRT2249514	hsa-miR-623	CLIP-seq
MIRT2249515	hsa-miR-651	CLIP-seq
MIRT2249516	hsa-miR-654-5p	CLIP-seq
MIRT2249517	hsa-miR-658	CLIP-seq
MIRT2249518	hsa-miR-762	CLIP-seq
MIRT1071310	hsa-miR-766	CLIP-seq
MIRT2249519	hsa-miR-940	CLIP-seq
MIRT2249461	hsa-miR-1321	CLIP-seq
MIRT2249480	hsa-miR-4270	CLIP-seq
MIRT2249484	hsa-miR-4441	CLIP-seq
MIRT2249500	hsa-miR-4739	CLIP-seq
MIRT2249503	hsa-miR-4756-5p	CLIP-seq
MIRT2552980	hsa-miR-1207-3p	CLIP-seq
MIRT2552981	hsa-miR-1301	CLIP-seq
MIRT1071270	hsa-miR-3192	CLIP-seq
MIRT2552982	hsa-miR-3667-5p	CLIP-seq
MIRT2552983	hsa-miR-4432	CLIP-seq
MIRT2552984	hsa-miR-451b	CLIP-seq
MIRT2552985	hsa-miR-4660	CLIP-seq
MIRT2552986	hsa-miR-4696	CLIP-seq
MIRT2552987	hsa-miR-4701-5p	CLIP-seq
MIRT1071295	hsa-miR-4793-3p	CLIP-seq
MIRT2552988	hsa-miR-5047	CLIP-seq
MIRT1071301	hsa-miR-508-5p	CLIP-seq
MIRT2552989	hsa-miR-588	CLIP-seq
MIRT1071307	hsa-miR-661	CLIP-seq
MIRT1071262	hsa-miR-668	CLIP-seq
MIRT1071310	hsa-miR-766	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BCL6	Repression	10601358
CEBPB	Activation	19717648
NFKB1	Activation	17018379
RELA	Activation	17018379
STAT6	Unknown	10601358

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000786	Component	Nucleosome	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12374808
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12374808
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	29537367, 36662884, 36917008
GO:0002376	Process	Immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	21903422, 32296183, 33951726
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	12374808
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	36917008
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	36917008
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	12374808
GO:0032736	Process	Positive regulation of interleukin-13 production	IDA	12374808
GO:0032743	Process	Positive regulation of interleukin-2 production	IDA	12374808
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	12374808
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0042110	Process	T cell activation	NAS	12374808
GO:0042832	Process	Defense response to protozoan	IEA
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045622	Process	Regulation of T-helper cell differentiation	NAS	12374808
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12374808
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12374808
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24995979
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 601900
• HGNC: 6119
• e!Ensembl: ENSG00000137265

Protein

• UniProt ID: Q15306
• Protein name: Interferon regulatory factor 4 (IRF-4) (Lymphocyte-specific interferon regulatory factor) (LSIRF) (Multiple myeloma oncogene 1) (NF-EM5)
• Protein function: Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transducti
• PDB: 2DLL, 6TD4, 7JM4, 7O56, 7OGS, 7OOT, 7RH2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00605	IRF	23 → 128	Interferon regulatory factor transcription factor	Domain
  PF10401	IRF-3	249 → 418	Interferon-regulatory factor 3	Family

• Tissue specificity: TISSUE SPECIFICITY: Lymphoid cells.
• Sequence:

  MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ
  DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
  PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD
  YVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIR
  SAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ
  RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFD
  TQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN
  SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

• Sequence length: 451

Pathways

KEGG:

Th17 cell differentiation

Reactome:

Interleukin-4 and Interleukin-13 signaling
Interferon gamma signaling
Interferon alpha/beta signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency 131	Pathogenic	rs2480826321, rs2480811054	RCV005208216 RCV005208218	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM OF EYE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM NON-HODGKIN LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHEMATOSQUAMOUS DERMATOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK MALIGNANT NEOPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRF4-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMITED SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMBRANOUS GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROSACEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBACEOUS GLAND DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC KERATOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN/HAIR/EYE PIGMENTATION 1, BLUE/NONBLUE EYES	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin/hair/eye pigmentation, variation in, 8	Affects	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEAL MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WALDENSTROM MACROGLOBULINEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WHIPPLE DISEASE	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	26276871		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	25724930		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23977280		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11299818		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	28604730		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28849037		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	18165800, 18815567, 23252516, 24875472, 25640395, 26414904, 31012208		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19804451, 21114485, 23647062		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10720141, 11749693, 11846984, 12360402, 17138822, 21680528, 28910419, 29540473, 29684346, 30057145		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	11749693		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	26437031		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	27803134		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	36917008	Associate	★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21919915, 26708394		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	27182965, 29146897		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22738254, 28851732		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	27182965, 29146897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	30601579		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	26617862		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26452539		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24213554, 27111665, 28706201, 33004899	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29720240, 30666255	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20674401, 22515488, 24074333		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	30087444	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	30929738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	36012391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	36674612	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25855937	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10720141, 10764139, 15959530, 16323006, 21487109, 25207815, 26983850, 28529614, 29397940, 29480878, 30380402, 31187530, 31773249		★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	27539887, 31174203		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	27539887, 31174203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	27539887, 31174203		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12393648	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23975422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	28251349, 32514046, 36046784	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	24074333		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16216037, 17651861, 17875505, 19144381, 20118770, 21740296, 23348205, 26173642, 28079574, 28086220, 30207048, 30907723		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19144381, 20080768, 35472072	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24970810	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26429873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21270109, 30520188	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36461603	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	40607252	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21270109, 27424798, 29054604	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21270109, 22512251, 30520188		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30357498		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36505471	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	22057235		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASDB_DG	22057235		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Nervous System Diseases	Central nervous system disease	Pubtator	34791573	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24510125, 28905935, 29131464, 29212740		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19897031		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30556855		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31632388		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18231914, 18758461, 19804451, 19897031, 21791429, 23708256, 25006123, 27232759, 29555645, 30277089, 31537531		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	18758461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	18758461, 22700719, 23770605, 24292274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	18758461, 22700719, 23770605, 24292274, 26956414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	37805677	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18535667, 21305677		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38274809	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33161410	Associate	★☆☆☆☆ Found in Text Mining only
Color Vision Defects	Color vision deficiency	Pubtator	18483556	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19679060		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24485021, 31558874, 33078631, 33478584	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	26276871, 30503671		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	34920653	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	31803627		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25855937	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18535667		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	19710684		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	26063186, 29622035		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27803134	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10720141, 12378521, 14556665, 15677569, 15816558, 16216037, 16823896, 17149956, 18165800, 18460403, 18628087, 18815567, 19706817, 19758698, 21487109, 21740296, 22503694, 22665537, 23252516, 23327292, 24040459, 24843885, 24875472, 25589617, 25640395, 26414904, 27837631, 28086220, 29251015, 29567771, 29738359, 30380402, 30601579, 31012208, 31169238, 31734190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33690729, 35993041	Associate	★☆☆☆☆ Found in Text Mining only
Epidermal Nevus	Epidermal nevus	Pubtator	25307738	Associate	★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	GWASDB_DG	22704111		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	28418867		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	28418867	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	34583923	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33902005	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Slack Skin	Granulomatous Slack Skin	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	23658517, 25207815, 28849037, 34913532	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23804646, 25207815, 27819673, 28849037, 29464072, 30376993		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	11013272		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23658517		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11972519, 17768115, 19804451, 19821826, 21114485, 21393330, 21424034, 22955914, 25232062, 32914098, 37935654	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17768115		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19804451, 21114485, 23647062		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30586599		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	31380412		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18535667, 21305677, 31014918		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34697723	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24510125, 29131464		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11091208, 21509436, 22090118, 23804715, 29397940		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	10720141, 21169992, 23716562, 25359993, 28529614, 29346274, 29588546, 31101622, 31570354		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34952945	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12218129, 16396836, 23977280	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	16396836, 19812605, 23977280, 25207815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	25207815	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	19897031	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23977280, 27517498	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27517498		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11749693, 11846984, 12360402, 29540473		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	11846984, 12218129		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	39808289	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27113098	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24213554, 26880555, 30666255, 33249782	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30666255		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10720141, 10764139, 11091208, 19298719, 19816150, 21487109, 23073988, 23445872, 23977280, 25207815, 25359993, 27616053, 28086220, 29464072, 30907723		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12079517, 18417578, 20118770, 21114485, 21487109, 22041376, 23977280, 23995111, 24970810, 25833963, 26731516, 30305637, 32843547, 35142151, 37935654	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25207815	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17296585, 21487109, 22102710, 23445872, 26307535, 32239695, 37561599	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	18987657, 19710685, 21169992, 22388754, 34622970	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10720141, 17138820, 17296585, 22102710, 23073988, 23445872, 26307535, 26621338, 31012208		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	17296585		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	10720141		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10720141, 12594241, 19390683, 19396635, 19897031, 23455380		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10720141, 12594241, 19396635		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	19812605, 26851186		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	21169992		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	12907442, 31570354	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	21169992, 21509436, 31570354		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23975422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30357498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	21270109, 24906573, 26928068		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20507321		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10720141, 15959530, 18417578, 19897031, 20182347, 21114485, 23666852, 23804646, 23977280, 24906573, 25207815, 25833963, 26928068, 29555645, 31666930		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10720141, 20956803, 26034867, 28628241, 31773249		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	10720141		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	36333264	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	20602913, 25307738, 28755520		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12920225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	20602913, 21270109, 21962134, 23537197, 25207815, 26857527, 28103633, 28755520, 29753029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	20602913, 21270109, 21962134, 23393597, 23537197, 26857527, 29753029, 30333196, 34293285, 34898573, 34915882, 36219477	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	25207815	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	21962134	Associate	★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	GWASCAT_DG	20585627, 30166351		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	28833354, 31773249		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10557056, 10720141, 15959530, 17149956, 18568025, 18759374, 18815567, 19144381, 21334719, 21454650, 21707574, 22718837, 22966948, 23138182, 23666852, 23977280, 23992230, 25987254, 26196464, 26269456, 26728187, 27223072, 27882933, 28025584, 28052011, 28083618, 28164410, 28529614, 28643330, 28751557, 28833354, 29156727, 29296880, 29317217, 29444873, 30098518, 31666930, 9326949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	10706878, 12079517, 12200383, 15578069, 17914559, 18987657, 21223249, 21393330, 21454650, 21707574, 22984542, 23541952, 23977280, 25978432, 26269456, 26282654, 26430725, 26728187, 26731516, 27223072, 27738323, 27882933, 28052011, 28083618, 28643330, 29166413, 29444873, 29654271, 31857430, 33152124, 33284947, 34136833, 34482362, 35544413, 36121114, 36678166, 36752202, 37767768, 40215234, 40532701	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	18568025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	25207815	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	30213928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29569949		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	29569949	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	34699105	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11013272, 16396836, 22003407		★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	19812605		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35697826, 37385124	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11781220, 16585013, 18417578, 18614198, 18815567, 19758698, 20182347, 20585039, 21680528, 21816905, 23658517, 23804646, 25833963, 28103633, 28296741, 28368411, 28849037, 29616123, 30376993, 31012208, 31537531		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30117603		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	20602913, 25307738, 28755520		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27113098, 28849037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	28434881		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	36797470	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	24039733		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30357498		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35012444	Associate	★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	Pubtator	15308563	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	33741391	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	23029519		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	23029519, 34859622	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	24604141, 25833963, 28529614		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	23977280		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	11299818		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	18417578, 24970810, 27490760		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	21169992		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASDB_DG	21685912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASCAT_DG	21685912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36012391, 37805677	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent bronchitis	Bronchitis	BEFREE	24074333		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31632388		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	31039827		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	28791349		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	28791349	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24213554, 26063186, 27111665, 28706201, 29023386, 30666255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	21919915, 26708394	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10527395		★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	12521125	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	32817485	Inhibit	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	27111665	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	37683642	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	GWASDB_DG	23548203		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	28706201	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21270109, 23548203, 25705849, 35018451	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	10720141		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	18758461, 22700719, 23770605, 24292274, 26956414		★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	28851732		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	24604141	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26452539	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21270109		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	GWASCAT_DG	26829030, 31174203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30376993		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35664436, 37491232	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36797470	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28849037		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	GWASCAT_DG	27424798		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20507321, 28418867, 35874675	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27111665		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10720141		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	11846984		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	31380412	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	11091208	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18535667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32420368	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34020619, 36308358	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	34424336	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	GWASCAT_DG	27723757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	28129744	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	17252022, 29348877, 30305637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	30305637	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Whipple Disease	Whipple disease	Pubtator	29537367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations