Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3660
Gene name	Interferon regulatory factor 2
Gene symbol	IRF2
Synonyms (NCBI Gene)	IRF-2
Chromosome	4
Chromosome location	4q35.1
Summary	IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that e

235

Show/Hide all (235)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	21880628
MIRT017202	hsa-miR-335-5p	Microarray	18185580
MIRT047780	hsa-miR-30d-5p	CLASH	23622248
MIRT536623	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT536622	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT536621	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536620	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT536619	hsa-miR-520b	PAR-CLIP	22012620
MIRT536618	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536617	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536616	hsa-miR-520e	PAR-CLIP	22012620
MIRT536615	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536614	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536613	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536612	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536611	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536609	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536608	hsa-miR-302e	PAR-CLIP	22012620
MIRT536607	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT536606	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT536605	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT536604	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT536603	hsa-miR-3607-3p	PAR-CLIP	22012620
MIRT536602	hsa-miR-298	PAR-CLIP	22012620
MIRT536600	hsa-miR-3686	PAR-CLIP	22012620
MIRT536601	hsa-miR-3658	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	22012620
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	22012620
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT536621	hsa-miR-18a-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26173586
MIRT536621	hsa-miR-18a-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26173586
MIRT536618	hsa-miR-520c-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28203525
MIRT536618	hsa-miR-520c-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28203525
MIRT733498	hsa-miR-204-5p	Luciferase reporter assayqRT-PCRWestern blotting	31934069
MIRT733498	hsa-miR-204-5p	Luciferase reporter assayqRT-PCRWestern blotting	31934069
MIRT737538	hsa-miR-204-3p	Luciferase reporter assayWestern blottingELISA	31934069
MIRT536623	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT536622	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT536621	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536620	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT536619	hsa-miR-520b	PAR-CLIP	22012620
MIRT536618	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536617	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536616	hsa-miR-520e	PAR-CLIP	22012620
MIRT536615	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536614	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536613	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536612	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536611	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536609	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536608	hsa-miR-302e	PAR-CLIP	22012620
MIRT536607	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT536606	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT536605	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT536604	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT536603	hsa-miR-3607-3p	PAR-CLIP	22012620
MIRT536602	hsa-miR-298	PAR-CLIP	22012620
MIRT536600	hsa-miR-3686	PAR-CLIP	22012620
MIRT536601	hsa-miR-3658	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	22012620
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	22012620
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT755962	gga-miR-455-5p	Luciferase reporter assayWestern blottingqRT-PCR	35806321
MIRT756288	hsa-miR-222-3p	Luciferase reporter assayWestern blottingqRT-PCR	37621743
MIRT1070875	hsa-miR-1	CLIP-seq
MIRT1070876	hsa-miR-1200	CLIP-seq
MIRT1070877	hsa-miR-1227	CLIP-seq
MIRT1070878	hsa-miR-1237	CLIP-seq
MIRT1070879	hsa-miR-1248	CLIP-seq
MIRT1070880	hsa-miR-1256	CLIP-seq
MIRT1070881	hsa-miR-1265	CLIP-seq
MIRT1070882	hsa-miR-1289	CLIP-seq
MIRT1070883	hsa-miR-1290	CLIP-seq
MIRT1070884	hsa-miR-1302	CLIP-seq
MIRT1070885	hsa-miR-2054	CLIP-seq
MIRT1070886	hsa-miR-206	CLIP-seq
MIRT1070887	hsa-miR-2110	CLIP-seq
MIRT1070888	hsa-miR-2278	CLIP-seq
MIRT1070889	hsa-miR-3064-3p	CLIP-seq
MIRT1070890	hsa-miR-3065-5p	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070892	hsa-miR-3121-5p	CLIP-seq
MIRT1070893	hsa-miR-3123	CLIP-seq
MIRT1070894	hsa-miR-3137	CLIP-seq
MIRT1070895	hsa-miR-3154	CLIP-seq
MIRT1070896	hsa-miR-3179	CLIP-seq
MIRT1070897	hsa-miR-3190	CLIP-seq
MIRT1070898	hsa-miR-3198	CLIP-seq
MIRT1070899	hsa-miR-342-5p	CLIP-seq
MIRT1070900	hsa-miR-3647-3p	CLIP-seq
MIRT1070901	hsa-miR-3659	CLIP-seq
MIRT1070902	hsa-miR-3673	CLIP-seq
MIRT1070903	hsa-miR-380	CLIP-seq
MIRT1070904	hsa-miR-3919	CLIP-seq
MIRT1070905	hsa-miR-3925-5p	CLIP-seq
MIRT1070906	hsa-miR-4271	CLIP-seq
MIRT1070907	hsa-miR-4274	CLIP-seq
MIRT1070908	hsa-miR-4279	CLIP-seq
MIRT1070909	hsa-miR-4294	CLIP-seq
MIRT1070910	hsa-miR-4298	CLIP-seq
MIRT1070911	hsa-miR-4309	CLIP-seq
MIRT1070912	hsa-miR-4311	CLIP-seq
MIRT1070913	hsa-miR-4324	CLIP-seq
MIRT1070914	hsa-miR-4422	CLIP-seq
MIRT1070915	hsa-miR-4424	CLIP-seq
MIRT1070916	hsa-miR-4457	CLIP-seq
MIRT1070917	hsa-miR-4473	CLIP-seq
MIRT1070918	hsa-miR-4476	CLIP-seq
MIRT1070919	hsa-miR-4491	CLIP-seq
MIRT1070920	hsa-miR-4505	CLIP-seq
MIRT1070921	hsa-miR-451b	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT1070924	hsa-miR-455-5p	CLIP-seq
MIRT1070925	hsa-miR-4657	CLIP-seq
MIRT1070926	hsa-miR-4658	CLIP-seq
MIRT1070927	hsa-miR-4659a-3p	CLIP-seq
MIRT1070928	hsa-miR-4659b-3p	CLIP-seq
MIRT1070929	hsa-miR-4663	CLIP-seq
MIRT1070930	hsa-miR-4664-5p	CLIP-seq
MIRT1070931	hsa-miR-4667-5p	CLIP-seq
MIRT1070932	hsa-miR-4677-3p	CLIP-seq
MIRT1070933	hsa-miR-4682	CLIP-seq
MIRT1070934	hsa-miR-4700-5p	CLIP-seq
MIRT1070935	hsa-miR-4725-3p	CLIP-seq
MIRT1070936	hsa-miR-4731-5p	CLIP-seq
MIRT1070937	hsa-miR-4732-5p	CLIP-seq
MIRT1070938	hsa-miR-4760-3p	CLIP-seq
MIRT1070939	hsa-miR-4764-5p	CLIP-seq
MIRT1070940	hsa-miR-4766-5p	CLIP-seq
MIRT1070941	hsa-miR-4778-3p	CLIP-seq
MIRT1070942	hsa-miR-485-5p	CLIP-seq
MIRT1070943	hsa-miR-498	CLIP-seq
MIRT1070944	hsa-miR-512-3p	CLIP-seq
MIRT1070945	hsa-miR-513b	CLIP-seq
MIRT1070946	hsa-miR-520f	CLIP-seq
MIRT1070947	hsa-miR-539	CLIP-seq
MIRT1070948	hsa-miR-544b	CLIP-seq
MIRT1070949	hsa-miR-574-5p	CLIP-seq
MIRT1070950	hsa-miR-579	CLIP-seq
MIRT1070951	hsa-miR-583	CLIP-seq
MIRT1070952	hsa-miR-613	CLIP-seq
MIRT1070953	hsa-miR-622	CLIP-seq
MIRT1070954	hsa-miR-648	CLIP-seq
MIRT1070955	hsa-miR-664	CLIP-seq
MIRT1070956	hsa-miR-671-5p	CLIP-seq
MIRT1070957	hsa-miR-942	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070916	hsa-miR-4457	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT1070880	hsa-miR-1256	CLIP-seq
MIRT1070883	hsa-miR-1290	CLIP-seq
MIRT2249351	hsa-miR-129-3p	CLIP-seq
MIRT2249352	hsa-miR-214	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070892	hsa-miR-3121-5p	CLIP-seq
MIRT1070895	hsa-miR-3154	CLIP-seq
MIRT2249353	hsa-miR-3155	CLIP-seq
MIRT2249354	hsa-miR-3155b	CLIP-seq
MIRT2249355	hsa-miR-3192	CLIP-seq
MIRT2249356	hsa-miR-338-3p	CLIP-seq
MIRT2249357	hsa-miR-3619-5p	CLIP-seq
MIRT1070900	hsa-miR-3647-3p	CLIP-seq
MIRT1070907	hsa-miR-4274	CLIP-seq
MIRT2249358	hsa-miR-4292	CLIP-seq
MIRT1070914	hsa-miR-4422	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT2249359	hsa-miR-4530	CLIP-seq
MIRT2249360	hsa-miR-4683	CLIP-seq
MIRT2249361	hsa-miR-4687-5p	CLIP-seq
MIRT2249362	hsa-miR-4690-5p	CLIP-seq
MIRT1070940	hsa-miR-4766-5p	CLIP-seq
MIRT2249363	hsa-miR-484	CLIP-seq
MIRT1070943	hsa-miR-498	CLIP-seq
MIRT1070946	hsa-miR-520f	CLIP-seq
MIRT1070953	hsa-miR-622	CLIP-seq
MIRT2249364	hsa-miR-761	CLIP-seq
MIRT1070883	hsa-miR-1290	CLIP-seq
MIRT2430078	hsa-miR-1827	CLIP-seq
MIRT2430079	hsa-miR-23a	CLIP-seq
MIRT2430080	hsa-miR-23b	CLIP-seq
MIRT2430081	hsa-miR-23c	CLIP-seq
MIRT2430082	hsa-miR-3176	CLIP-seq
MIRT2430083	hsa-miR-3200-3p	CLIP-seq
MIRT2430084	hsa-miR-3922-3p	CLIP-seq
MIRT2430085	hsa-miR-4267	CLIP-seq
MIRT2430086	hsa-miR-4303	CLIP-seq
MIRT2430087	hsa-miR-4649-3p	CLIP-seq
MIRT1070881	hsa-miR-1265	CLIP-seq
MIRT1070885	hsa-miR-2054	CLIP-seq
MIRT1070889	hsa-miR-3064-3p	CLIP-seq
MIRT2552935	hsa-miR-340	CLIP-seq
MIRT1070903	hsa-miR-380	CLIP-seq
MIRT2552936	hsa-miR-4282	CLIP-seq
MIRT1070916	hsa-miR-4457	CLIP-seq
MIRT2552937	hsa-miR-4718	CLIP-seq
MIRT2552938	hsa-miR-513a-3p	CLIP-seq
MIRT2552939	hsa-miR-577	CLIP-seq
MIRT2682911	hsa-miR-4323	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CIITA	Unknown	15950283
IRF1	Activation	9054665
PITX1	Repression	12242290

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	7507207
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	9540062
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	9540062
GO:0002376	Process	Immune system process	IBA
GO:0003677	Function	DNA binding	IDA	9540062
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	9540062
GO:0005515	Function	Protein binding	IPI	9540062, 21903422, 25609649, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	9540062
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008283	Process	Cell population proliferation	TAS	8438157
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9540062
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0051607	Process	Defense response to virus	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
147576	6117	ENSG00000168310

P14316

Protein name

Interferon regulatory factor 2 (IRF-2)

Protein function

Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constit

PDB

8YTG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00605	IRF	7 → 112	Interferon regulatory factor transcription factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed throughout the epithelium of the colon. Also expressed in lamina propria. {ECO:0000269|PubMed:15226432}.

Sequence

MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK
KGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQ
SHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVP
SDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP
YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC

Sequence length

349

Interactions

View interactions

	Reactome
			Interferon gamma signaling Interferon alpha/beta signaling Factors involved in megakaryocyte development and platelet production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (91)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Medulloblastoma	Medulloblastoma	BEFREE	9649118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29274321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28769762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25994869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28769762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12220551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14565859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11323500, 14651776, 16241857, 35441810, 37584152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9261415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22119988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	10942060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11323500	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22561517, 25021421, 32671843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11323500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27246609, 28471447, 30017880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19170204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12788988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	9649118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23487038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21859832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33161410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28465494, 30734278, 30905761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21859832, 25541970, 28465494, 30991021, 33787608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26936111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26936111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29305258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22113474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11721886, 22113474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	14962090, 29305258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23487038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11721886, 22113474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35993041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	33880370	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18281489, 28467773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18281489, 28467773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28467773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	36899621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26173586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33902005	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11323500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35212366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	11721886, 29305258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	10609788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16051824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34952945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27576016		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17073600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11559933, 21880628, 30876449, 37621743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11559933, 18575764, 28579269, 30876449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22561517, 22805863, 24379610, 29386090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	22561517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25285625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25285625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22119988	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17363571, 18281489, 28467773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27246609, 28471447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19170204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22119988, 24632547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24607843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26173586, 31350707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18575764, 22119988, 28465494, 29599126, 30017880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21859832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	9649118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18511292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30017880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32902917, 36341357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	19888305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	19888305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	8795694, 9204971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28831010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10609788, 17073600, 17363571, 18575764, 22561517, 24632547, 26173586, 27463676, 30905761, 31350707, 31471524, 7630638, 8795694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8550813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34312772	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28344004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	28344004, 34743649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30127908		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19170204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27806724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22119988, 24632547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	10956389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22119988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35012444	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	22042864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24607843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	14962090, 15086546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	14962090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	36833372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21859832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26173586, 31350707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20507321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29563175		★★★★★ ★☆☆☆☆ Found in Text Mining only

IRF2 (interferon regulatory factor 2)