Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	366
Gene name	Aquaporin 9
Gene symbol	AQP9
Synonyms (NCBI Gene)	AQP-9HsT17287SSC1T17287
Chromosome	15
Chromosome location	15q21.3
Summary	The aquaporins are a family of water-selective membrane channels. This gene encodes a member of a subset of aquaporins called the aquaglyceroporins. This protein allows passage of a broad range of noncharged solutes and also stimulates urea transport and

188

Show/Hide all (188)

miRTarBase ID	miRNA	Experiments
MIRT791576	hsa-miR-18a	CLIP-seq
MIRT791577	hsa-miR-18b	CLIP-seq
MIRT791578	hsa-miR-300	CLIP-seq
MIRT791579	hsa-miR-3136-5p	CLIP-seq
MIRT791580	hsa-miR-324-5p	CLIP-seq
MIRT791581	hsa-miR-381	CLIP-seq
MIRT791582	hsa-miR-4439	CLIP-seq
MIRT791583	hsa-miR-4513	CLIP-seq
MIRT791584	hsa-miR-4645-3p	CLIP-seq
MIRT791585	hsa-miR-4666-3p	CLIP-seq
MIRT791586	hsa-miR-4712-5p	CLIP-seq
MIRT791587	hsa-miR-4735-3p	CLIP-seq
MIRT791588	hsa-miR-4789-5p	CLIP-seq
MIRT791589	hsa-miR-493	CLIP-seq
MIRT791590	hsa-miR-514	CLIP-seq
MIRT791591	hsa-miR-514b-3p	CLIP-seq
MIRT791592	hsa-miR-770-5p	CLIP-seq
MIRT791593	hsa-miR-943	CLIP-seq
MIRT1920265	hsa-miR-224	CLIP-seq
MIRT1920266	hsa-miR-4803	CLIP-seq
MIRT1920267	hsa-miR-494	CLIP-seq
MIRT1933501	hsa-miR-3155	CLIP-seq
MIRT1933502	hsa-miR-3155b	CLIP-seq
MIRT1933503	hsa-miR-4694-3p	CLIP-seq
MIRT1933504	hsa-miR-484	CLIP-seq
MIRT1933505	hsa-miR-522	CLIP-seq
MIRT1933506	hsa-miR-548c-3p	CLIP-seq
MIRT1933507	hsa-miR-587	CLIP-seq
MIRT1933508	hsa-miR-885-5p	CLIP-seq
MIRT2173577	hsa-miR-1207-5p	CLIP-seq
MIRT2173578	hsa-miR-3065-3p	CLIP-seq
MIRT2173579	hsa-miR-3074-3p	CLIP-seq
MIRT2173580	hsa-miR-3153	CLIP-seq
MIRT2173581	hsa-miR-330-3p	CLIP-seq
MIRT2173582	hsa-miR-3907	CLIP-seq
MIRT2173583	hsa-miR-4259	CLIP-seq
MIRT2173584	hsa-miR-4425	CLIP-seq
MIRT2173585	hsa-miR-4668-5p	CLIP-seq
MIRT2173586	hsa-miR-4736	CLIP-seq
MIRT2173587	hsa-miR-4763-3p	CLIP-seq
MIRT2477160	hsa-miR-1263	CLIP-seq
MIRT2477161	hsa-miR-1270	CLIP-seq
MIRT2477162	hsa-miR-1301	CLIP-seq
MIRT2477163	hsa-miR-130a	CLIP-seq
MIRT2477164	hsa-miR-130b	CLIP-seq
MIRT2477165	hsa-miR-151-5p	CLIP-seq
MIRT2477166	hsa-miR-151b	CLIP-seq
MIRT2477167	hsa-miR-185	CLIP-seq
MIRT2477168	hsa-miR-2909	CLIP-seq
MIRT2477169	hsa-miR-296-3p	CLIP-seq
MIRT791578	hsa-miR-300	CLIP-seq
MIRT2477170	hsa-miR-301a	CLIP-seq
MIRT2477171	hsa-miR-301b	CLIP-seq
MIRT2477172	hsa-miR-3064-3p	CLIP-seq
MIRT2173579	hsa-miR-3074-3p	CLIP-seq
MIRT2477173	hsa-miR-3123	CLIP-seq
MIRT2477174	hsa-miR-3127-3p	CLIP-seq
MIRT2477175	hsa-miR-3131	CLIP-seq
MIRT2477176	hsa-miR-3162-3p	CLIP-seq
MIRT2477177	hsa-miR-3185	CLIP-seq
MIRT2477178	hsa-miR-3199	CLIP-seq
MIRT2477179	hsa-miR-3605-5p	CLIP-seq
MIRT2477180	hsa-miR-3666	CLIP-seq
MIRT2477181	hsa-miR-380	CLIP-seq
MIRT791581	hsa-miR-381	CLIP-seq
MIRT2477182	hsa-miR-3909	CLIP-seq
MIRT2477183	hsa-miR-3944-5p	CLIP-seq
MIRT2477184	hsa-miR-4267	CLIP-seq
MIRT2477185	hsa-miR-4295	CLIP-seq
MIRT2477186	hsa-miR-4297	CLIP-seq
MIRT2477187	hsa-miR-4306	CLIP-seq
MIRT2477188	hsa-miR-4434	CLIP-seq
MIRT2477189	hsa-miR-4436b-3p	CLIP-seq
MIRT2477190	hsa-miR-4464	CLIP-seq
MIRT2477191	hsa-miR-4471	CLIP-seq
MIRT2477192	hsa-miR-4473	CLIP-seq
MIRT2477193	hsa-miR-4516	CLIP-seq
MIRT2477194	hsa-miR-451b	CLIP-seq
MIRT2477195	hsa-miR-4531	CLIP-seq
MIRT2477196	hsa-miR-454	CLIP-seq
MIRT2477197	hsa-miR-4644	CLIP-seq
MIRT2477198	hsa-miR-4660	CLIP-seq
MIRT791585	hsa-miR-4666-3p	CLIP-seq
MIRT2477199	hsa-miR-4671-3p	CLIP-seq
MIRT2477200	hsa-miR-4709-3p	CLIP-seq
MIRT791586	hsa-miR-4712-5p	CLIP-seq
MIRT2477201	hsa-miR-4722-5p	CLIP-seq
MIRT2477202	hsa-miR-4724-5p	CLIP-seq
MIRT2477203	hsa-miR-4733-5p	CLIP-seq
MIRT2477204	hsa-miR-4748	CLIP-seq
MIRT2477205	hsa-miR-4753-3p	CLIP-seq
MIRT2477206	hsa-miR-4762-3p	CLIP-seq
MIRT2477207	hsa-miR-4768-3p	CLIP-seq
MIRT2477208	hsa-miR-4781-5p	CLIP-seq
MIRT791588	hsa-miR-4789-5p	CLIP-seq
MIRT2477209	hsa-miR-4804-3p	CLIP-seq
MIRT2477210	hsa-miR-485-3p	CLIP-seq
MIRT2477211	hsa-miR-5047	CLIP-seq
MIRT2477212	hsa-miR-510	CLIP-seq
MIRT2477213	hsa-miR-511	CLIP-seq
MIRT2477214	hsa-miR-512-3p	CLIP-seq
MIRT2477215	hsa-miR-512-5p	CLIP-seq
MIRT2477216	hsa-miR-520a-5p	CLIP-seq
MIRT2477217	hsa-miR-520f	CLIP-seq
MIRT2477218	hsa-miR-525-5p	CLIP-seq
MIRT2477219	hsa-miR-550a	CLIP-seq
MIRT2477220	hsa-miR-611	CLIP-seq
MIRT2477221	hsa-miR-620	CLIP-seq
MIRT2477222	hsa-miR-659	CLIP-seq
MIRT2477223	hsa-miR-671-5p	CLIP-seq
MIRT791592	hsa-miR-770-5p	CLIP-seq
MIRT2477160	hsa-miR-1263	CLIP-seq
MIRT2477161	hsa-miR-1270	CLIP-seq
MIRT2675201	hsa-miR-1273d	CLIP-seq
MIRT2477162	hsa-miR-1301	CLIP-seq
MIRT2477163	hsa-miR-130a	CLIP-seq
MIRT2477164	hsa-miR-130b	CLIP-seq
MIRT2477165	hsa-miR-151-5p	CLIP-seq
MIRT2477166	hsa-miR-151b	CLIP-seq
MIRT2477167	hsa-miR-185	CLIP-seq
MIRT2477168	hsa-miR-2909	CLIP-seq
MIRT2477169	hsa-miR-296-3p	CLIP-seq
MIRT791578	hsa-miR-300	CLIP-seq
MIRT2477170	hsa-miR-301a	CLIP-seq
MIRT2477171	hsa-miR-301b	CLIP-seq
MIRT2477172	hsa-miR-3064-3p	CLIP-seq
MIRT2173579	hsa-miR-3074-3p	CLIP-seq
MIRT2477173	hsa-miR-3123	CLIP-seq
MIRT2477174	hsa-miR-3127-3p	CLIP-seq
MIRT2675202	hsa-miR-3127-5p	CLIP-seq
MIRT2477175	hsa-miR-3131	CLIP-seq
MIRT2477176	hsa-miR-3162-3p	CLIP-seq
MIRT2477177	hsa-miR-3185	CLIP-seq
MIRT2477178	hsa-miR-3199	CLIP-seq
MIRT2477179	hsa-miR-3605-5p	CLIP-seq
MIRT2675203	hsa-miR-3646	CLIP-seq
MIRT2477180	hsa-miR-3666	CLIP-seq
MIRT2477181	hsa-miR-380	CLIP-seq
MIRT791581	hsa-miR-381	CLIP-seq
MIRT2477182	hsa-miR-3909	CLIP-seq
MIRT2477183	hsa-miR-3944-5p	CLIP-seq
MIRT2477184	hsa-miR-4267	CLIP-seq
MIRT2675204	hsa-miR-4291	CLIP-seq
MIRT2477185	hsa-miR-4295	CLIP-seq
MIRT2477186	hsa-miR-4297	CLIP-seq
MIRT2477187	hsa-miR-4306	CLIP-seq
MIRT2477188	hsa-miR-4434	CLIP-seq
MIRT2477189	hsa-miR-4436b-3p	CLIP-seq
MIRT2477190	hsa-miR-4464	CLIP-seq
MIRT2477191	hsa-miR-4471	CLIP-seq
MIRT2477192	hsa-miR-4473	CLIP-seq
MIRT2477193	hsa-miR-4516	CLIP-seq
MIRT2477194	hsa-miR-451b	CLIP-seq
MIRT2477195	hsa-miR-4531	CLIP-seq
MIRT2477196	hsa-miR-454	CLIP-seq
MIRT2477197	hsa-miR-4644	CLIP-seq
MIRT2477198	hsa-miR-4660	CLIP-seq
MIRT791585	hsa-miR-4666-3p	CLIP-seq
MIRT2477199	hsa-miR-4671-3p	CLIP-seq
MIRT2675205	hsa-miR-4687-3p	CLIP-seq
MIRT2477200	hsa-miR-4709-3p	CLIP-seq
MIRT791586	hsa-miR-4712-5p	CLIP-seq
MIRT2477201	hsa-miR-4722-5p	CLIP-seq
MIRT2477202	hsa-miR-4724-5p	CLIP-seq
MIRT2477203	hsa-miR-4733-5p	CLIP-seq
MIRT2477204	hsa-miR-4748	CLIP-seq
MIRT2477205	hsa-miR-4753-3p	CLIP-seq
MIRT2477206	hsa-miR-4762-3p	CLIP-seq
MIRT2477207	hsa-miR-4768-3p	CLIP-seq
MIRT2477208	hsa-miR-4781-5p	CLIP-seq
MIRT791588	hsa-miR-4789-5p	CLIP-seq
MIRT2477209	hsa-miR-4804-3p	CLIP-seq
MIRT2477210	hsa-miR-485-3p	CLIP-seq
MIRT2477211	hsa-miR-5047	CLIP-seq
MIRT2477212	hsa-miR-510	CLIP-seq
MIRT2477213	hsa-miR-511	CLIP-seq
MIRT2477214	hsa-miR-512-3p	CLIP-seq
MIRT2477215	hsa-miR-512-5p	CLIP-seq
MIRT2477216	hsa-miR-520a-5p	CLIP-seq
MIRT2477217	hsa-miR-520f	CLIP-seq
MIRT2477218	hsa-miR-525-5p	CLIP-seq
MIRT2675206	hsa-miR-545	CLIP-seq
MIRT2477219	hsa-miR-550a	CLIP-seq
MIRT2477220	hsa-miR-611	CLIP-seq
MIRT2477221	hsa-miR-620	CLIP-seq
MIRT2477222	hsa-miR-659	CLIP-seq
MIRT2477223	hsa-miR-671-5p	CLIP-seq
MIRT791592	hsa-miR-770-5p	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005345	Function	Purine nucleobase transmembrane transporter activity	ISS
GO:0005350	Function	Pyrimidine nucleobase transmembrane transporter activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9514918
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006833	Process	Water transport	IBA
GO:0006833	Process	Water transport	IDA	30420639
GO:0006863	Process	Purine nucleobase transport	ISS
GO:0015204	Function	Urea transmembrane transporter activity	IBA
GO:0015204	Function	Urea transmembrane transporter activity	ISS
GO:0015250	Function	Water channel activity	IBA
GO:0015250	Function	Water channel activity	IDA	9514918, 30420639
GO:0015250	Function	Water channel activity	IEA
GO:0015254	Function	Glycerol channel activity	EXP	10564231, 18762715
GO:0015254	Function	Glycerol channel activity	IBA
GO:0015254	Function	Glycerol channel activity	IDA	9514918
GO:0015254	Function	Glycerol channel activity	IDA	10564231, 30420639, 35054513
GO:0015265	Function	Urea channel activity	IDA	9514918, 10564231
GO:0015265	Function	Urea channel activity	IEA
GO:0015267	Function	Channel activity	IDA	10564231, 35054513
GO:0015267	Function	Channel activity	IEA
GO:0015793	Process	Glycerol transmembrane transport	IBA
GO:0015793	Process	Glycerol transmembrane transport	IDA	30420639
GO:0015793	Process	Glycerol transmembrane transport	TAS
GO:0015837	Process	Amine transport	ISS
GO:0015855	Process	Pyrimidine nucleobase transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	18718702
GO:0055085	Process	Transmembrane transport	IEA
GO:0071320	Process	Cellular response to cAMP	IEP	17636236
GO:0071722	Process	Detoxification of arsenic-containing substance	IEA
GO:0071722	Process	Detoxification of arsenic-containing substance	ISS
GO:0071918	Process	Urea transmembrane transport	IMP	9514918
GO:0072531	Process	Pyrimidine-containing compound transmembrane transport	IEA
GO:0080170	Process	Hydrogen peroxide transmembrane transport	IEA
GO:0140070	Function	Hydrogen peroxide channel activity	IEA
GO:0140070	Function	Hydrogen peroxide channel activity	IMP	26837049
GO:1904823	Process	Purine nucleobase transmembrane transport	IEA

MIM	HGNC	e!Ensembl
602914	643	ENSG00000103569

O43315

Protein name

Aquaporin-9 (AQP-9) (Aquaglyceroporin-9) (Small solute channel 1)

Protein function

Aquaglyceroporins form homotetrameric transmembrane channels, with each monomer independently mediating glycerol and water transport across the plasma membrane along their osmotic gradient (PubMed:10564231, PubMed:30420639, PubMed:35054513, PubM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00230	MIP	17 → 262	Major intrinsic protein	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen. {ECO:0000269|PubMed:10564231, ECO:0000269|PubMed:9514918}.

Sequence

MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITI
NVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATV
FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIF
DSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAG
NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM

Sequence length

295

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation Bile secretion		Transport of glycerol from adipocytes to the liver by Aquaporins Passive transport by Aquaporins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (110)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	16968895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	16968895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	16968895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11972053, 23563754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	23563754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27329843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	19805235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27026296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	29485906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30344749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17525633, 24086629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18652774, 24086629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30863160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	33247170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33247170, 37681917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27026296, 36212175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31969493	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31703694, 35245343	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36254092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28419510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27329843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30386332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28640255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31703694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33936061, 36792688, 39475676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28384265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29901079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28942694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	40055514	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29523003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37773841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30598999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29890131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18401671, 19615702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29351212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31070762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28715131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	32714978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31275413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	23464865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17525633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24086629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24086629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24086629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17525633, 24086629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24086629, 33637089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	22319637, 37334672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25626709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25626709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	20378617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21289260, 29523003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	21502813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29720337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32309443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28258570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27218255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	27218255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27885529, 28419510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35477402	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	15336539		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25953102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	16968895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	16968895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16968895, 27022216, 27026296, 27216981, 27329843, 28258570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16968895, 27216981, 27329843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24643204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30863160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27329843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27187384, 30176851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27216981, 28798983		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22130551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22130551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	27218255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28049557, 30598999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30598999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16968895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29928570, 30017933, 31218464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35231061, 37334672, 37891664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33564686	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17525633, 18652774, 24086629, 27022216, 27216981, 28640255, 31703694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24065273, 31275413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18401671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21502813, 30598999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	18401671, 19615702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	21819701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21819701, 29472315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37761834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29566083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20378617, 31258711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33579525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27187384, 30176851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27187384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30176851	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33247170, 36655999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27026296, 28938959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29449936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	28968830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33466212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36389709	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24065273, 31275413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	29678898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29678898, 33247170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32309443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	28968830		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28968830		★★★★★ ★☆☆☆☆ Found in Text Mining only

AQP9 (aquaporin 9)