IRF1 (interferon regulatory factor 1)

Gene

• Entrez ID: 3659
• Gene name: Interferon regulatory factor 1
• Gene symbol: IRF1
• Synonyms (NCBI Gene): IMD117, IRF-1, MAR
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body`s r

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121912469	T>A	Pathogenic	Missense variant, coding sequence variant, intron variant, non coding transcript variant
rs121912470	A>G	Pathogenic	Missense variant, coding sequence variant, intron variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004627	hsa-miR-342-3p	Review	20026422
MIRT006535	hsa-miR-383-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	21368870
MIRT006535	hsa-miR-383-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	21368870
MIRT006535	hsa-miR-383-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	21368870
MIRT006535	hsa-miR-383-5p	Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	21368870
MIRT027994	hsa-miR-93-5p	Sequencing	20371350
MIRT038441	hsa-miR-296-3p	CLASH	23622248
MIRT053354	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23785404
MIRT053354	hsa-miR-23a-3p	GFP reporter assay, qRT-PCR, Western blot	23785404
MIRT053354	hsa-miR-23a-3p	GFP reporter assay, qRT-PCR, Western blot	23785404
MIRT637977	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT637976	hsa-miR-764	HITS-CLIP	23824327
MIRT637975	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677719	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT677718	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT637971	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT637970	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT637969	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT637968	hsa-miR-640	HITS-CLIP	23824327
MIRT637977	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT637976	hsa-miR-764	HITS-CLIP	23824327
MIRT637975	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT637971	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT637970	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT637968	hsa-miR-640	HITS-CLIP	23824327
MIRT672615	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT672613	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT672612	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT672611	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT672609	hsa-miR-3666	HITS-CLIP	23824327
MIRT672610	hsa-miR-4295	HITS-CLIP	23824327
MIRT672608	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT672607	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT672606	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672605	hsa-miR-6073	HITS-CLIP	23824327
MIRT672604	hsa-miR-142-3p	HITS-CLIP	23824327
MIRT672603	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT672602	hsa-miR-4671-3p	HITS-CLIP	23824327
MIRT637977	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT637976	hsa-miR-764	HITS-CLIP	23824327
MIRT637975	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT637974	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT637973	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT637972	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT637971	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT637970	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT637969	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT637968	hsa-miR-640	HITS-CLIP	23824327
MIRT727421	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT727422	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT672613	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR	25617495
MIRT672613	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR	25617495
MIRT672613	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR	25617495
MIRT672613	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR	25617495
MIRT672613	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR	25617495
MIRT053354	hsa-miR-23a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27279136
MIRT053354	hsa-miR-23a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27279136
MIRT733129	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	32801770
MIRT637977	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT637976	hsa-miR-764	HITS-CLIP	23824327
MIRT637975	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677719	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT677718	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT637971	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT637970	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT637969	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT637968	hsa-miR-640	HITS-CLIP	23824327
MIRT637977	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT637976	hsa-miR-764	HITS-CLIP	23824327
MIRT637975	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT637971	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT637970	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT637968	hsa-miR-640	HITS-CLIP	23824327
MIRT672615	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT672613	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT672612	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT672611	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT672609	hsa-miR-3666	HITS-CLIP	23824327
MIRT672610	hsa-miR-4295	HITS-CLIP	23824327
MIRT672608	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT672607	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT672606	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672605	hsa-miR-6073	HITS-CLIP	23824327
MIRT672604	hsa-miR-142-3p	HITS-CLIP	23824327
MIRT672603	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT672602	hsa-miR-4671-3p	HITS-CLIP	23824327
MIRT637977	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT637976	hsa-miR-764	HITS-CLIP	23824327
MIRT637975	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT637974	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT637973	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT637972	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT637971	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT637970	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT637969	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT637968	hsa-miR-640	HITS-CLIP	23824327
MIRT1070773	hsa-miR-106a	CLIP-seq
MIRT1070774	hsa-miR-106b	CLIP-seq
MIRT1070775	hsa-miR-1193	CLIP-seq
MIRT1070776	hsa-miR-1206	CLIP-seq
MIRT1070777	hsa-miR-122	CLIP-seq
MIRT1070778	hsa-miR-1224-3p	CLIP-seq
MIRT1070779	hsa-miR-1290	CLIP-seq
MIRT1070780	hsa-miR-129-5p	CLIP-seq
MIRT1070781	hsa-miR-130a	CLIP-seq
MIRT1070782	hsa-miR-130b	CLIP-seq
MIRT1070783	hsa-miR-139-3p	CLIP-seq
MIRT1070784	hsa-miR-150	CLIP-seq
MIRT1070785	hsa-miR-1538	CLIP-seq
MIRT1070786	hsa-miR-17	CLIP-seq
MIRT1070787	hsa-miR-1913	CLIP-seq
MIRT1070788	hsa-miR-197	CLIP-seq
MIRT1070789	hsa-miR-1976	CLIP-seq
MIRT1070790	hsa-miR-20a	CLIP-seq
MIRT1070791	hsa-miR-20b	CLIP-seq
MIRT1070792	hsa-miR-218	CLIP-seq
MIRT1070793	hsa-miR-2392	CLIP-seq
MIRT1070794	hsa-miR-301a	CLIP-seq
MIRT1070795	hsa-miR-301b	CLIP-seq
MIRT1070796	hsa-miR-302a	CLIP-seq
MIRT1070797	hsa-miR-302b	CLIP-seq
MIRT1070798	hsa-miR-302c	CLIP-seq
MIRT1070799	hsa-miR-302d	CLIP-seq
MIRT1070800	hsa-miR-302e	CLIP-seq
MIRT1070801	hsa-miR-31	CLIP-seq
MIRT1070802	hsa-miR-3135b	CLIP-seq
MIRT1070803	hsa-miR-3152-3p	CLIP-seq
MIRT1070804	hsa-miR-3157-5p	CLIP-seq
MIRT1070805	hsa-miR-3177-5p	CLIP-seq
MIRT1070806	hsa-miR-3187-3p	CLIP-seq
MIRT1070807	hsa-miR-3194-3p	CLIP-seq
MIRT1070808	hsa-miR-3199	CLIP-seq
MIRT1070809	hsa-miR-324-3p	CLIP-seq
MIRT1070810	hsa-miR-3591-5p	CLIP-seq
MIRT1070811	hsa-miR-3652	CLIP-seq
MIRT738597	hsa-miR-3655	CLIP-seq
MIRT1070812	hsa-miR-3663-5p	CLIP-seq
MIRT738599	hsa-miR-3672	CLIP-seq
MIRT1070813	hsa-miR-3688-5p	CLIP-seq
MIRT1070814	hsa-miR-371-5p	CLIP-seq
MIRT1070815	hsa-miR-371b-5p	CLIP-seq
MIRT1070816	hsa-miR-372	CLIP-seq
MIRT1070817	hsa-miR-373	CLIP-seq
MIRT1070818	hsa-miR-383	CLIP-seq
MIRT1070819	hsa-miR-3934	CLIP-seq
MIRT1070820	hsa-miR-3977	CLIP-seq
MIRT1070821	hsa-miR-4258	CLIP-seq
MIRT1070822	hsa-miR-4269	CLIP-seq
MIRT1070823	hsa-miR-4279	CLIP-seq
MIRT1070824	hsa-miR-4280	CLIP-seq
MIRT1070825	hsa-miR-4430	CLIP-seq
MIRT1070826	hsa-miR-4435	CLIP-seq
MIRT1070827	hsa-miR-4438	CLIP-seq
MIRT1070828	hsa-miR-4454	CLIP-seq
MIRT1070829	hsa-miR-4473	CLIP-seq
MIRT1070830	hsa-miR-4480	CLIP-seq
MIRT1070831	hsa-miR-454	CLIP-seq
MIRT738598	hsa-miR-4639-3p	CLIP-seq
MIRT1070832	hsa-miR-4662a-5p	CLIP-seq
MIRT1070833	hsa-miR-4676-5p	CLIP-seq
MIRT1070834	hsa-miR-4695-3p	CLIP-seq
MIRT1070835	hsa-miR-4701-5p	CLIP-seq
MIRT1070836	hsa-miR-4707-3p	CLIP-seq
MIRT1070837	hsa-miR-4716-5p	CLIP-seq
MIRT1070838	hsa-miR-4722-3p	CLIP-seq
MIRT1070839	hsa-miR-4729	CLIP-seq
MIRT1070840	hsa-miR-4731-5p	CLIP-seq
MIRT1070841	hsa-miR-4733-3p	CLIP-seq
MIRT1070842	hsa-miR-4735-5p	CLIP-seq
MIRT1070843	hsa-miR-4740-3p	CLIP-seq
MIRT1070844	hsa-miR-4745-3p	CLIP-seq
MIRT1070845	hsa-miR-4747-3p	CLIP-seq
MIRT1070846	hsa-miR-4753-3p	CLIP-seq
MIRT1070847	hsa-miR-4755-3p	CLIP-seq
MIRT1070848	hsa-miR-4768-5p	CLIP-seq
MIRT1070849	hsa-miR-4772-5p	CLIP-seq
MIRT1070850	hsa-miR-4775	CLIP-seq
MIRT1070851	hsa-miR-4781-3p	CLIP-seq
MIRT1070852	hsa-miR-5095	CLIP-seq
MIRT1070853	hsa-miR-5096	CLIP-seq
MIRT1070854	hsa-miR-512-3p	CLIP-seq
MIRT1070855	hsa-miR-519d	CLIP-seq
MIRT1070856	hsa-miR-520a-3p	CLIP-seq
MIRT1070857	hsa-miR-520b	CLIP-seq
MIRT1070858	hsa-miR-520c-3p	CLIP-seq
MIRT1070859	hsa-miR-520d-3p	CLIP-seq
MIRT1070860	hsa-miR-520e	CLIP-seq
MIRT1070861	hsa-miR-520g	CLIP-seq
MIRT1070862	hsa-miR-520h	CLIP-seq
MIRT1070863	hsa-miR-548s	CLIP-seq
MIRT1070864	hsa-miR-548t	CLIP-seq
MIRT1070865	hsa-miR-552	CLIP-seq
MIRT1070866	hsa-miR-575	CLIP-seq
MIRT1070867	hsa-miR-578	CLIP-seq
MIRT1070868	hsa-miR-579	CLIP-seq
MIRT1070869	hsa-miR-581	CLIP-seq
MIRT1070870	hsa-miR-588	CLIP-seq
MIRT1070871	hsa-miR-590-3p	CLIP-seq
MIRT1070872	hsa-miR-636	CLIP-seq
MIRT1070873	hsa-miR-664	CLIP-seq
MIRT1070874	hsa-miR-93	CLIP-seq
MIRT738597	hsa-miR-3655	CLIP-seq
MIRT738599	hsa-miR-3672	CLIP-seq
MIRT738598	hsa-miR-4639-3p	CLIP-seq
MIRT1070775	hsa-miR-1193	CLIP-seq
MIRT1070780	hsa-miR-129-5p	CLIP-seq
MIRT1070789	hsa-miR-1976	CLIP-seq
MIRT1070793	hsa-miR-2392	CLIP-seq
MIRT1070803	hsa-miR-3152-3p	CLIP-seq
MIRT1921649	hsa-miR-411	CLIP-seq
MIRT1070828	hsa-miR-4454	CLIP-seq
MIRT1070832	hsa-miR-4662a-5p	CLIP-seq
MIRT1070833	hsa-miR-4676-5p	CLIP-seq
MIRT1070834	hsa-miR-4695-3p	CLIP-seq
MIRT1070836	hsa-miR-4707-3p	CLIP-seq
MIRT1921650	hsa-miR-483-5p	CLIP-seq
MIRT1070853	hsa-miR-5096	CLIP-seq
MIRT1070866	hsa-miR-575	CLIP-seq
MIRT1070775	hsa-miR-1193	CLIP-seq
MIRT1070778	hsa-miR-1224-3p	CLIP-seq
MIRT1922155	hsa-miR-143	CLIP-seq
MIRT1070787	hsa-miR-1913	CLIP-seq
MIRT1070788	hsa-miR-197	CLIP-seq
MIRT1070789	hsa-miR-1976	CLIP-seq
MIRT1070793	hsa-miR-2392	CLIP-seq
MIRT1070803	hsa-miR-3152-3p	CLIP-seq
MIRT1070806	hsa-miR-3187-3p	CLIP-seq
MIRT1070809	hsa-miR-324-3p	CLIP-seq
MIRT1070812	hsa-miR-3663-5p	CLIP-seq
MIRT1070814	hsa-miR-371-5p	CLIP-seq
MIRT1070815	hsa-miR-371b-5p	CLIP-seq
MIRT1070819	hsa-miR-3934	CLIP-seq
MIRT1921649	hsa-miR-411	CLIP-seq
MIRT1070826	hsa-miR-4435	CLIP-seq
MIRT1070828	hsa-miR-4454	CLIP-seq
MIRT1070832	hsa-miR-4662a-5p	CLIP-seq
MIRT1070833	hsa-miR-4676-5p	CLIP-seq
MIRT1070834	hsa-miR-4695-3p	CLIP-seq
MIRT1070835	hsa-miR-4701-5p	CLIP-seq
MIRT1070836	hsa-miR-4707-3p	CLIP-seq
MIRT1070837	hsa-miR-4716-5p	CLIP-seq
MIRT1070847	hsa-miR-4755-3p	CLIP-seq
MIRT1922156	hsa-miR-4770	CLIP-seq
MIRT1070851	hsa-miR-4781-3p	CLIP-seq
MIRT1921650	hsa-miR-483-5p	CLIP-seq
MIRT1070853	hsa-miR-5096	CLIP-seq
MIRT1070863	hsa-miR-548s	CLIP-seq
MIRT1070866	hsa-miR-575	CLIP-seq
MIRT1070870	hsa-miR-588	CLIP-seq
MIRT1070773	hsa-miR-106a	CLIP-seq
MIRT1070774	hsa-miR-106b	CLIP-seq
MIRT1070775	hsa-miR-1193	CLIP-seq
MIRT1070776	hsa-miR-1206	CLIP-seq
MIRT1070777	hsa-miR-122	CLIP-seq
MIRT2017415	hsa-miR-1267	CLIP-seq
MIRT2017416	hsa-miR-1292	CLIP-seq
MIRT1070780	hsa-miR-129-5p	CLIP-seq
MIRT2017417	hsa-miR-1307	CLIP-seq
MIRT1070781	hsa-miR-130a	CLIP-seq
MIRT1070782	hsa-miR-130b	CLIP-seq
MIRT2017418	hsa-miR-1470	CLIP-seq
MIRT1070784	hsa-miR-150	CLIP-seq
MIRT1070785	hsa-miR-1538	CLIP-seq
MIRT1070786	hsa-miR-17	CLIP-seq
MIRT2017419	hsa-miR-1915	CLIP-seq
MIRT1070788	hsa-miR-197	CLIP-seq
MIRT1070789	hsa-miR-1976	CLIP-seq
MIRT1070790	hsa-miR-20a	CLIP-seq
MIRT1070791	hsa-miR-20b	CLIP-seq
MIRT2017420	hsa-miR-2276	CLIP-seq
MIRT1070793	hsa-miR-2392	CLIP-seq
MIRT2017421	hsa-miR-23a	CLIP-seq
MIRT2017422	hsa-miR-23b	CLIP-seq
MIRT2017423	hsa-miR-23c	CLIP-seq
MIRT2017424	hsa-miR-2861	CLIP-seq
MIRT1070794	hsa-miR-301a	CLIP-seq
MIRT1070795	hsa-miR-301b	CLIP-seq
MIRT2017425	hsa-miR-3119	CLIP-seq
MIRT2017426	hsa-miR-3122	CLIP-seq
MIRT1070802	hsa-miR-3135b	CLIP-seq
MIRT2017427	hsa-miR-3140-3p	CLIP-seq
MIRT1070803	hsa-miR-3152-3p	CLIP-seq
MIRT2017428	hsa-miR-3159	CLIP-seq
MIRT2017429	hsa-miR-3168	CLIP-seq
MIRT1070806	hsa-miR-3187-3p	CLIP-seq
MIRT1070807	hsa-miR-3194-3p	CLIP-seq
MIRT2017430	hsa-miR-329	CLIP-seq
MIRT2017431	hsa-miR-3622b-5p	CLIP-seq
MIRT2017432	hsa-miR-362-3p	CLIP-seq
MIRT1070811	hsa-miR-3652	CLIP-seq
MIRT738597	hsa-miR-3655	CLIP-seq
MIRT1070812	hsa-miR-3663-5p	CLIP-seq
MIRT1070814	hsa-miR-371-5p	CLIP-seq
MIRT1070815	hsa-miR-371b-5p	CLIP-seq
MIRT2017433	hsa-miR-3913-5p	CLIP-seq
MIRT1070819	hsa-miR-3934	CLIP-seq
MIRT2017434	hsa-miR-3941	CLIP-seq
MIRT1070823	hsa-miR-4279	CLIP-seq
MIRT2017435	hsa-miR-4284	CLIP-seq
MIRT2017436	hsa-miR-4286	CLIP-seq
MIRT2017437	hsa-miR-4292	CLIP-seq
MIRT2017438	hsa-miR-4308	CLIP-seq
MIRT2017439	hsa-miR-4314	CLIP-seq
MIRT2017440	hsa-miR-4420	CLIP-seq
MIRT1070825	hsa-miR-4430	CLIP-seq
MIRT1070826	hsa-miR-4435	CLIP-seq
MIRT1070827	hsa-miR-4438	CLIP-seq
MIRT1070828	hsa-miR-4454	CLIP-seq
MIRT2017441	hsa-miR-4471	CLIP-seq
MIRT1070831	hsa-miR-454	CLIP-seq
MIRT738598	hsa-miR-4639-3p	CLIP-seq
MIRT2017442	hsa-miR-466	CLIP-seq
MIRT1070832	hsa-miR-4662a-5p	CLIP-seq
MIRT2017443	hsa-miR-4667-3p	CLIP-seq
MIRT2017444	hsa-miR-4667-5p	CLIP-seq
MIRT2017445	hsa-miR-4672	CLIP-seq
MIRT1070833	hsa-miR-4676-5p	CLIP-seq
MIRT1070834	hsa-miR-4695-3p	CLIP-seq
MIRT2017446	hsa-miR-4699-3p	CLIP-seq
MIRT2017447	hsa-miR-4700-5p	CLIP-seq
MIRT1070835	hsa-miR-4701-5p	CLIP-seq
MIRT1070836	hsa-miR-4707-3p	CLIP-seq
MIRT1070837	hsa-miR-4716-5p	CLIP-seq
MIRT1070839	hsa-miR-4729	CLIP-seq
MIRT1070841	hsa-miR-4733-3p	CLIP-seq
MIRT1070842	hsa-miR-4735-5p	CLIP-seq
MIRT1070844	hsa-miR-4745-3p	CLIP-seq
MIRT1070845	hsa-miR-4747-3p	CLIP-seq
MIRT1070847	hsa-miR-4755-3p	CLIP-seq
MIRT1070848	hsa-miR-4768-5p	CLIP-seq
MIRT2017448	hsa-miR-4772-3p	CLIP-seq
MIRT1070850	hsa-miR-4775	CLIP-seq
MIRT1070851	hsa-miR-4781-3p	CLIP-seq
MIRT1070852	hsa-miR-5095	CLIP-seq
MIRT1070853	hsa-miR-5096	CLIP-seq
MIRT1070855	hsa-miR-519d	CLIP-seq
MIRT1070861	hsa-miR-520g	CLIP-seq
MIRT1070862	hsa-miR-520h	CLIP-seq
MIRT1070863	hsa-miR-548s	CLIP-seq
MIRT1070866	hsa-miR-575	CLIP-seq
MIRT1070868	hsa-miR-579	CLIP-seq
MIRT1070870	hsa-miR-588	CLIP-seq
MIRT1070871	hsa-miR-590-3p	CLIP-seq
MIRT2017449	hsa-miR-603	CLIP-seq
MIRT2017450	hsa-miR-615-5p	CLIP-seq
MIRT2017451	hsa-miR-637	CLIP-seq
MIRT2017452	hsa-miR-642a	CLIP-seq
MIRT1070873	hsa-miR-664	CLIP-seq
MIRT2017453	hsa-miR-892b	CLIP-seq
MIRT2017454	hsa-miR-9	CLIP-seq
MIRT1070874	hsa-miR-93	CLIP-seq
MIRT1070773	hsa-miR-106a	CLIP-seq
MIRT1070774	hsa-miR-106b	CLIP-seq
MIRT1070775	hsa-miR-1193	CLIP-seq
MIRT2249315	hsa-miR-1200	CLIP-seq
MIRT1070776	hsa-miR-1206	CLIP-seq
MIRT1070777	hsa-miR-122	CLIP-seq
MIRT2017416	hsa-miR-1292	CLIP-seq
MIRT2249316	hsa-miR-1293	CLIP-seq
MIRT1070780	hsa-miR-129-5p	CLIP-seq
MIRT2249317	hsa-miR-1297	CLIP-seq
MIRT2017417	hsa-miR-1307	CLIP-seq
MIRT1070781	hsa-miR-130a	CLIP-seq
MIRT1070782	hsa-miR-130b	CLIP-seq
MIRT2249318	hsa-miR-132	CLIP-seq
MIRT1922155	hsa-miR-143	CLIP-seq
MIRT1070784	hsa-miR-150	CLIP-seq
MIRT1070786	hsa-miR-17	CLIP-seq
MIRT2017419	hsa-miR-1915	CLIP-seq
MIRT1070788	hsa-miR-197	CLIP-seq
MIRT1070789	hsa-miR-1976	CLIP-seq
MIRT1070790	hsa-miR-20a	CLIP-seq
MIRT1070791	hsa-miR-20b	CLIP-seq
MIRT2249319	hsa-miR-2117	CLIP-seq
MIRT2249320	hsa-miR-212	CLIP-seq
MIRT2017420	hsa-miR-2276	CLIP-seq
MIRT1070793	hsa-miR-2392	CLIP-seq
MIRT2249321	hsa-miR-2467-3p	CLIP-seq
MIRT2249322	hsa-miR-26a	CLIP-seq
MIRT2249323	hsa-miR-26b	CLIP-seq
MIRT1070794	hsa-miR-301a	CLIP-seq
MIRT1070795	hsa-miR-301b	CLIP-seq
MIRT1070796	hsa-miR-302a	CLIP-seq
MIRT1070797	hsa-miR-302b	CLIP-seq
MIRT1070798	hsa-miR-302c	CLIP-seq
MIRT1070799	hsa-miR-302d	CLIP-seq
MIRT1070800	hsa-miR-302e	CLIP-seq
MIRT2017425	hsa-miR-3119	CLIP-seq
MIRT2017426	hsa-miR-3122	CLIP-seq
MIRT2249324	hsa-miR-3132	CLIP-seq
MIRT1070802	hsa-miR-3135b	CLIP-seq
MIRT1070803	hsa-miR-3152-3p	CLIP-seq
MIRT2249325	hsa-miR-3152-5p	CLIP-seq
MIRT2017429	hsa-miR-3168	CLIP-seq
MIRT2249326	hsa-miR-3178	CLIP-seq
MIRT2249327	hsa-miR-3184	CLIP-seq
MIRT1070807	hsa-miR-3194-3p	CLIP-seq
MIRT2249328	hsa-miR-3194-5p	CLIP-seq
MIRT2249329	hsa-miR-330-3p	CLIP-seq
MIRT2017431	hsa-miR-3622b-5p	CLIP-seq
MIRT1070811	hsa-miR-3652	CLIP-seq
MIRT2249330	hsa-miR-3678-3p	CLIP-seq
MIRT1070816	hsa-miR-372	CLIP-seq
MIRT1070817	hsa-miR-373	CLIP-seq
MIRT2017433	hsa-miR-3913-5p	CLIP-seq
MIRT1070819	hsa-miR-3934	CLIP-seq
MIRT1921649	hsa-miR-411	CLIP-seq
MIRT2249331	hsa-miR-423-5p	CLIP-seq
MIRT2249332	hsa-miR-4273	CLIP-seq
MIRT2017435	hsa-miR-4284	CLIP-seq
MIRT2017437	hsa-miR-4292	CLIP-seq
MIRT2249333	hsa-miR-4324	CLIP-seq
MIRT2017440	hsa-miR-4420	CLIP-seq
MIRT1070825	hsa-miR-4430	CLIP-seq
MIRT1070827	hsa-miR-4438	CLIP-seq
MIRT2249334	hsa-miR-4451	CLIP-seq
MIRT1070828	hsa-miR-4454	CLIP-seq
MIRT2249335	hsa-miR-4465	CLIP-seq
MIRT2017441	hsa-miR-4471	CLIP-seq
MIRT1070829	hsa-miR-4473	CLIP-seq
MIRT2249336	hsa-miR-4483	CLIP-seq
MIRT2249337	hsa-miR-4492	CLIP-seq
MIRT2249338	hsa-miR-4498	CLIP-seq
MIRT1070831	hsa-miR-454	CLIP-seq
MIRT2249339	hsa-miR-4651	CLIP-seq
MIRT1070832	hsa-miR-4662a-5p	CLIP-seq
MIRT1070833	hsa-miR-4676-5p	CLIP-seq
MIRT2249340	hsa-miR-4685-5p	CLIP-seq
MIRT1070834	hsa-miR-4695-3p	CLIP-seq
MIRT1070835	hsa-miR-4701-5p	CLIP-seq
MIRT1070836	hsa-miR-4707-3p	CLIP-seq
MIRT1070837	hsa-miR-4716-5p	CLIP-seq
MIRT2249341	hsa-miR-4726-3p	CLIP-seq
MIRT1070839	hsa-miR-4729	CLIP-seq
MIRT1070840	hsa-miR-4731-5p	CLIP-seq
MIRT2249342	hsa-miR-4732-5p	CLIP-seq
MIRT1070842	hsa-miR-4735-5p	CLIP-seq
MIRT1070846	hsa-miR-4753-3p	CLIP-seq
MIRT1070848	hsa-miR-4768-5p	CLIP-seq
MIRT1922156	hsa-miR-4770	CLIP-seq
MIRT2017448	hsa-miR-4772-3p	CLIP-seq
MIRT1070850	hsa-miR-4775	CLIP-seq
MIRT1070851	hsa-miR-4781-3p	CLIP-seq
MIRT1921650	hsa-miR-483-5p	CLIP-seq
MIRT2249343	hsa-miR-498	CLIP-seq
MIRT2249344	hsa-miR-509-3p	CLIP-seq
MIRT1070852	hsa-miR-5095	CLIP-seq
MIRT1070853	hsa-miR-5096	CLIP-seq
MIRT1070854	hsa-miR-512-3p	CLIP-seq
MIRT1070855	hsa-miR-519d	CLIP-seq
MIRT1070856	hsa-miR-520a-3p	CLIP-seq
MIRT1070857	hsa-miR-520b	CLIP-seq
MIRT1070858	hsa-miR-520c-3p	CLIP-seq
MIRT1070859	hsa-miR-520d-3p	CLIP-seq
MIRT1070860	hsa-miR-520e	CLIP-seq
MIRT2249345	hsa-miR-520f	CLIP-seq
MIRT1070861	hsa-miR-520g	CLIP-seq
MIRT1070862	hsa-miR-520h	CLIP-seq
MIRT2249346	hsa-miR-541	CLIP-seq
MIRT2249347	hsa-miR-544b	CLIP-seq
MIRT1070865	hsa-miR-552	CLIP-seq
MIRT1070866	hsa-miR-575	CLIP-seq
MIRT1070868	hsa-miR-579	CLIP-seq
MIRT1070870	hsa-miR-588	CLIP-seq
MIRT1070871	hsa-miR-590-3p	CLIP-seq
MIRT2249348	hsa-miR-608	CLIP-seq
MIRT2249349	hsa-miR-654-5p	CLIP-seq
MIRT1070873	hsa-miR-664	CLIP-seq
MIRT2249350	hsa-miR-762	CLIP-seq
MIRT2017453	hsa-miR-892b	CLIP-seq
MIRT2017454	hsa-miR-9	CLIP-seq
MIRT1070874	hsa-miR-93	CLIP-seq
MIRT1070777	hsa-miR-122	CLIP-seq
MIRT1070781	hsa-miR-130a	CLIP-seq
MIRT1070782	hsa-miR-130b	CLIP-seq
MIRT1070794	hsa-miR-301a	CLIP-seq
MIRT1070795	hsa-miR-301b	CLIP-seq
MIRT1070796	hsa-miR-302a	CLIP-seq
MIRT1070797	hsa-miR-302b	CLIP-seq
MIRT1070798	hsa-miR-302c	CLIP-seq
MIRT1070799	hsa-miR-302d	CLIP-seq
MIRT1070800	hsa-miR-302e	CLIP-seq
MIRT1070802	hsa-miR-3135b	CLIP-seq
MIRT2017431	hsa-miR-3622b-5p	CLIP-seq
MIRT1070811	hsa-miR-3652	CLIP-seq
MIRT1070816	hsa-miR-372	CLIP-seq
MIRT1070817	hsa-miR-373	CLIP-seq
MIRT1070825	hsa-miR-4430	CLIP-seq
MIRT2249337	hsa-miR-4492	CLIP-seq
MIRT2249338	hsa-miR-4498	CLIP-seq
MIRT1070831	hsa-miR-454	CLIP-seq
MIRT1070833	hsa-miR-4676-5p	CLIP-seq
MIRT1070856	hsa-miR-520a-3p	CLIP-seq
MIRT1070857	hsa-miR-520b	CLIP-seq
MIRT1070858	hsa-miR-520c-3p	CLIP-seq
MIRT1070859	hsa-miR-520d-3p	CLIP-seq
MIRT1070860	hsa-miR-520e	CLIP-seq
MIRT1070866	hsa-miR-575	CLIP-seq
MIRT2249350	hsa-miR-762	CLIP-seq
MIRT2017419	hsa-miR-1915	CLIP-seq
MIRT2249325	hsa-miR-3152-5p	CLIP-seq
MIRT2249341	hsa-miR-4726-3p	CLIP-seq
MIRT1070846	hsa-miR-4753-3p	CLIP-seq
MIRT2249343	hsa-miR-498	CLIP-seq
MIRT2552866	hsa-miR-1	CLIP-seq
MIRT2249315	hsa-miR-1200	CLIP-seq
MIRT2552867	hsa-miR-1207-5p	CLIP-seq
MIRT2552868	hsa-miR-1237	CLIP-seq
MIRT2552869	hsa-miR-124	CLIP-seq
MIRT2552870	hsa-miR-1248	CLIP-seq
MIRT2552871	hsa-miR-125a-5p	CLIP-seq
MIRT2552872	hsa-miR-125b	CLIP-seq
MIRT2017415	hsa-miR-1267	CLIP-seq
MIRT2249316	hsa-miR-1293	CLIP-seq
MIRT1070780	hsa-miR-129-5p	CLIP-seq
MIRT2249317	hsa-miR-1297	CLIP-seq
MIRT2017417	hsa-miR-1307	CLIP-seq
MIRT1070781	hsa-miR-130a	CLIP-seq
MIRT1070782	hsa-miR-130b	CLIP-seq
MIRT1070783	hsa-miR-139-3p	CLIP-seq
MIRT2017418	hsa-miR-1470	CLIP-seq
MIRT1070785	hsa-miR-1538	CLIP-seq
MIRT2552873	hsa-miR-1827	CLIP-seq
MIRT2552874	hsa-miR-1912	CLIP-seq
MIRT2017419	hsa-miR-1915	CLIP-seq
MIRT2552875	hsa-miR-193b	CLIP-seq
MIRT2552876	hsa-miR-206	CLIP-seq
MIRT2552877	hsa-miR-2114	CLIP-seq
MIRT2552878	hsa-miR-2277-3p	CLIP-seq
MIRT2249322	hsa-miR-26a	CLIP-seq
MIRT2249323	hsa-miR-26b	CLIP-seq
MIRT2017424	hsa-miR-2861	CLIP-seq
MIRT1070794	hsa-miR-301a	CLIP-seq
MIRT1070795	hsa-miR-301b	CLIP-seq
MIRT1070796	hsa-miR-302a	CLIP-seq
MIRT1070797	hsa-miR-302b	CLIP-seq
MIRT1070798	hsa-miR-302c	CLIP-seq
MIRT1070799	hsa-miR-302d	CLIP-seq
MIRT1070800	hsa-miR-302e	CLIP-seq
MIRT1070801	hsa-miR-31	CLIP-seq
MIRT2552879	hsa-miR-3130-5p	CLIP-seq
MIRT2249325	hsa-miR-3152-5p	CLIP-seq
MIRT2552880	hsa-miR-3176	CLIP-seq
MIRT1070805	hsa-miR-3177-5p	CLIP-seq
MIRT2249326	hsa-miR-3178	CLIP-seq
MIRT2249327	hsa-miR-3184	CLIP-seq
MIRT2552881	hsa-miR-335	CLIP-seq
MIRT2552882	hsa-miR-337-3p	CLIP-seq
MIRT2552883	hsa-miR-33a	CLIP-seq
MIRT2552884	hsa-miR-33b	CLIP-seq
MIRT1070810	hsa-miR-3591-5p	CLIP-seq
MIRT2552885	hsa-miR-3612	CLIP-seq
MIRT2552886	hsa-miR-3616-3p	CLIP-seq
MIRT2552887	hsa-miR-3661	CLIP-seq
MIRT1070812	hsa-miR-3663-5p	CLIP-seq
MIRT2552888	hsa-miR-3691-3p	CLIP-seq
MIRT1070816	hsa-miR-372	CLIP-seq
MIRT1070817	hsa-miR-373	CLIP-seq
MIRT2552889	hsa-miR-3918	CLIP-seq
MIRT2552890	hsa-miR-3922-3p	CLIP-seq
MIRT2552891	hsa-miR-410	CLIP-seq
MIRT2249331	hsa-miR-423-5p	CLIP-seq
MIRT2552892	hsa-miR-425	CLIP-seq
MIRT1070821	hsa-miR-4258	CLIP-seq
MIRT1070824	hsa-miR-4280	CLIP-seq
MIRT2552893	hsa-miR-4283	CLIP-seq
MIRT2017435	hsa-miR-4284	CLIP-seq
MIRT2017437	hsa-miR-4292	CLIP-seq
MIRT2552894	hsa-miR-4294	CLIP-seq
MIRT2552895	hsa-miR-4299	CLIP-seq
MIRT2552896	hsa-miR-4307	CLIP-seq
MIRT2017438	hsa-miR-4308	CLIP-seq
MIRT2552897	hsa-miR-4319	CLIP-seq
MIRT2249333	hsa-miR-4324	CLIP-seq
MIRT2552898	hsa-miR-4326	CLIP-seq
MIRT2552899	hsa-miR-4330	CLIP-seq
MIRT2552900	hsa-miR-4421	CLIP-seq
MIRT2552901	hsa-miR-4446-3p	CLIP-seq
MIRT2552902	hsa-miR-4459	CLIP-seq
MIRT2249335	hsa-miR-4465	CLIP-seq
MIRT2552903	hsa-miR-4482	CLIP-seq
MIRT2249336	hsa-miR-4483	CLIP-seq
MIRT2552904	hsa-miR-4489	CLIP-seq
MIRT2552905	hsa-miR-450b-5p	CLIP-seq
MIRT2552906	hsa-miR-4532	CLIP-seq
MIRT1070831	hsa-miR-454	CLIP-seq
MIRT2552907	hsa-miR-4640-5p	CLIP-seq
MIRT2249339	hsa-miR-4651	CLIP-seq
MIRT2017443	hsa-miR-4667-3p	CLIP-seq
MIRT2552908	hsa-miR-4695-5p	CLIP-seq
MIRT2552909	hsa-miR-4708-3p	CLIP-seq
MIRT2552910	hsa-miR-4721	CLIP-seq
MIRT1070838	hsa-miR-4722-3p	CLIP-seq
MIRT2249341	hsa-miR-4726-3p	CLIP-seq
MIRT2552911	hsa-miR-4726-5p	CLIP-seq
MIRT2552912	hsa-miR-4727-5p	CLIP-seq
MIRT1070840	hsa-miR-4731-5p	CLIP-seq
MIRT2552913	hsa-miR-4732-3p	CLIP-seq
MIRT1070841	hsa-miR-4733-3p	CLIP-seq
MIRT1070842	hsa-miR-4735-5p	CLIP-seq
MIRT1070844	hsa-miR-4745-3p	CLIP-seq
MIRT1070845	hsa-miR-4747-3p	CLIP-seq
MIRT1070846	hsa-miR-4753-3p	CLIP-seq
MIRT2552914	hsa-miR-4753-5p	CLIP-seq
MIRT2552915	hsa-miR-4763-3p	CLIP-seq
MIRT2552916	hsa-miR-4763-5p	CLIP-seq
MIRT1070850	hsa-miR-4775	CLIP-seq
MIRT2552917	hsa-miR-4787-5p	CLIP-seq
MIRT2249343	hsa-miR-498	CLIP-seq
MIRT2552918	hsa-miR-506	CLIP-seq
MIRT2552919	hsa-miR-507	CLIP-seq
MIRT2552920	hsa-miR-518a-5p	CLIP-seq
MIRT1070856	hsa-miR-520a-3p	CLIP-seq
MIRT1070857	hsa-miR-520b	CLIP-seq
MIRT1070858	hsa-miR-520c-3p	CLIP-seq
MIRT1070859	hsa-miR-520d-3p	CLIP-seq
MIRT1070860	hsa-miR-520e	CLIP-seq
MIRT2552921	hsa-miR-527	CLIP-seq
MIRT2249346	hsa-miR-541	CLIP-seq
MIRT2249347	hsa-miR-544b	CLIP-seq
MIRT2552922	hsa-miR-548ac	CLIP-seq
MIRT2552923	hsa-miR-548d-3p	CLIP-seq
MIRT2552924	hsa-miR-548z	CLIP-seq
MIRT1070865	hsa-miR-552	CLIP-seq
MIRT2552925	hsa-miR-557	CLIP-seq
MIRT2552926	hsa-miR-568	CLIP-seq
MIRT1070871	hsa-miR-590-3p	CLIP-seq
MIRT2249348	hsa-miR-608	CLIP-seq
MIRT2552927	hsa-miR-613	CLIP-seq
MIRT2552928	hsa-miR-625	CLIP-seq
MIRT2552929	hsa-miR-631	CLIP-seq
MIRT2017452	hsa-miR-642a	CLIP-seq
MIRT2552930	hsa-miR-650	CLIP-seq
MIRT2249349	hsa-miR-654-5p	CLIP-seq
MIRT2552931	hsa-miR-665	CLIP-seq
MIRT2552932	hsa-miR-670	CLIP-seq
MIRT2552933	hsa-miR-720	CLIP-seq
MIRT2552934	hsa-miR-940	CLIP-seq
MIRT2249315	hsa-miR-1200	CLIP-seq
MIRT2552867	hsa-miR-1207-5p	CLIP-seq
MIRT2552869	hsa-miR-124	CLIP-seq
MIRT2552871	hsa-miR-125a-5p	CLIP-seq
MIRT2552872	hsa-miR-125b	CLIP-seq
MIRT2017415	hsa-miR-1267	CLIP-seq
MIRT2249316	hsa-miR-1293	CLIP-seq
MIRT1070780	hsa-miR-129-5p	CLIP-seq
MIRT2017417	hsa-miR-1307	CLIP-seq
MIRT1070781	hsa-miR-130a	CLIP-seq
MIRT1070782	hsa-miR-130b	CLIP-seq
MIRT2017418	hsa-miR-1470	CLIP-seq
MIRT1070785	hsa-miR-1538	CLIP-seq
MIRT2552873	hsa-miR-1827	CLIP-seq
MIRT2552874	hsa-miR-1912	CLIP-seq
MIRT2017419	hsa-miR-1915	CLIP-seq
MIRT2552875	hsa-miR-193b	CLIP-seq
MIRT2552877	hsa-miR-2114	CLIP-seq
MIRT2552878	hsa-miR-2277-3p	CLIP-seq
MIRT2017424	hsa-miR-2861	CLIP-seq
MIRT1070794	hsa-miR-301a	CLIP-seq
MIRT1070795	hsa-miR-301b	CLIP-seq
MIRT1070796	hsa-miR-302a	CLIP-seq
MIRT1070797	hsa-miR-302b	CLIP-seq
MIRT1070798	hsa-miR-302c	CLIP-seq
MIRT1070799	hsa-miR-302d	CLIP-seq
MIRT1070800	hsa-miR-302e	CLIP-seq
MIRT1070801	hsa-miR-31	CLIP-seq
MIRT2552879	hsa-miR-3130-5p	CLIP-seq
MIRT2249325	hsa-miR-3152-5p	CLIP-seq
MIRT2249326	hsa-miR-3178	CLIP-seq
MIRT2249327	hsa-miR-3184	CLIP-seq
MIRT2552885	hsa-miR-3612	CLIP-seq
MIRT2552886	hsa-miR-3616-3p	CLIP-seq
MIRT2552887	hsa-miR-3661	CLIP-seq
MIRT1070812	hsa-miR-3663-5p	CLIP-seq
MIRT2552888	hsa-miR-3691-3p	CLIP-seq
MIRT1070816	hsa-miR-372	CLIP-seq
MIRT1070817	hsa-miR-373	CLIP-seq
MIRT2552889	hsa-miR-3918	CLIP-seq
MIRT2249331	hsa-miR-423-5p	CLIP-seq
MIRT1070821	hsa-miR-4258	CLIP-seq
MIRT2552893	hsa-miR-4283	CLIP-seq
MIRT2017435	hsa-miR-4284	CLIP-seq
MIRT2017437	hsa-miR-4292	CLIP-seq
MIRT2552895	hsa-miR-4299	CLIP-seq
MIRT2552896	hsa-miR-4307	CLIP-seq
MIRT2017438	hsa-miR-4308	CLIP-seq
MIRT2552897	hsa-miR-4319	CLIP-seq
MIRT2249333	hsa-miR-4324	CLIP-seq
MIRT2552899	hsa-miR-4330	CLIP-seq
MIRT2552900	hsa-miR-4421	CLIP-seq
MIRT2552901	hsa-miR-4446-3p	CLIP-seq
MIRT2552902	hsa-miR-4459	CLIP-seq
MIRT2552903	hsa-miR-4482	CLIP-seq
MIRT2249336	hsa-miR-4483	CLIP-seq
MIRT2552904	hsa-miR-4489	CLIP-seq
MIRT2552905	hsa-miR-450b-5p	CLIP-seq
MIRT1070831	hsa-miR-454	CLIP-seq
MIRT2552907	hsa-miR-4640-5p	CLIP-seq
MIRT2249339	hsa-miR-4651	CLIP-seq
MIRT2017443	hsa-miR-4667-3p	CLIP-seq
MIRT2552908	hsa-miR-4695-5p	CLIP-seq
MIRT2552909	hsa-miR-4708-3p	CLIP-seq
MIRT2552910	hsa-miR-4721	CLIP-seq
MIRT2249341	hsa-miR-4726-3p	CLIP-seq
MIRT2552911	hsa-miR-4726-5p	CLIP-seq
MIRT1070840	hsa-miR-4731-5p	CLIP-seq
MIRT2552913	hsa-miR-4732-3p	CLIP-seq
MIRT1070842	hsa-miR-4735-5p	CLIP-seq
MIRT1070844	hsa-miR-4745-3p	CLIP-seq
MIRT1070845	hsa-miR-4747-3p	CLIP-seq
MIRT1070846	hsa-miR-4753-3p	CLIP-seq
MIRT2552915	hsa-miR-4763-3p	CLIP-seq
MIRT1070850	hsa-miR-4775	CLIP-seq
MIRT2249343	hsa-miR-498	CLIP-seq
MIRT2552918	hsa-miR-506	CLIP-seq
MIRT2552919	hsa-miR-507	CLIP-seq
MIRT1070856	hsa-miR-520a-3p	CLIP-seq
MIRT1070857	hsa-miR-520b	CLIP-seq
MIRT1070858	hsa-miR-520c-3p	CLIP-seq
MIRT1070859	hsa-miR-520d-3p	CLIP-seq
MIRT1070860	hsa-miR-520e	CLIP-seq
MIRT2249346	hsa-miR-541	CLIP-seq
MIRT2249347	hsa-miR-544b	CLIP-seq
MIRT2552922	hsa-miR-548ac	CLIP-seq
MIRT2552923	hsa-miR-548d-3p	CLIP-seq
MIRT2552924	hsa-miR-548z	CLIP-seq
MIRT1070865	hsa-miR-552	CLIP-seq
MIRT2552925	hsa-miR-557	CLIP-seq
MIRT2552926	hsa-miR-568	CLIP-seq
MIRT1070871	hsa-miR-590-3p	CLIP-seq
MIRT2249348	hsa-miR-608	CLIP-seq
MIRT2552929	hsa-miR-631	CLIP-seq
MIRT2017452	hsa-miR-642a	CLIP-seq
MIRT2552930	hsa-miR-650	CLIP-seq
MIRT2249349	hsa-miR-654-5p	CLIP-seq
MIRT2552931	hsa-miR-665	CLIP-seq
MIRT2552932	hsa-miR-670	CLIP-seq
MIRT2552934	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Unknown	12052885;15950283
CREBBP	Activation	18497060
NFKB1	Activation	18694960
NFKB1	Unknown	12077266
RELA	Activation	18694960
RELA	Unknown	12077266
STAT1	Activation	18497060;18694960;8647845
STAT1	Repression	22002246
STAT1	Unknown	10068671;10764778;12077266;18401423;24478085
STAT2	Activation	8647845
STAT3	Activation	8647845
STAT3	Unknown	10068671
STAT4	Unknown	10068671;10358173

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	18035482
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	32385160
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	32385160
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18035482
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	15509808
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	32385160
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	15509808
GO:0002376	Process	Immune system process	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002819	Process	Regulation of adaptive immune response	TAS	11846971
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	11846971
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10702232, 15509808, 17942705, 32878885, 32911434
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	32385160
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	11846971
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IDA	19851330
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	11846974
GO:0010468	Process	Regulation of gene expression	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032481	Process	Positive regulation of type I interferon production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	21389130
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0034124	Process	Regulation of MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0034124	Process	Regulation of MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0035458	Process	Cellular response to interferon-beta	IDA	18035482
GO:0043374	Process	CD8-positive, alpha-beta T cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045088	Process	Regulation of innate immune response	TAS	11846971
GO:0045590	Process	Negative regulation of regulatory T cell differentiation	IEA
GO:0045590	Process	Negative regulation of regulatory T cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18084608, 22200613
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	22200613
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	15509808, 17516545, 19851330, 22367195
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	15509808, 32385160
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0051607	Process	Defense response to virus	IDA	21389130, 21478870
GO:0051607	Process	Defense response to virus	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	22200613
GO:0051726	Process	Regulation of cell cycle	TAS	11846974
GO:0060333	Process	Type II interferon-mediated signaling pathway	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:2000564	Process	Regulation of CD8-positive, alpha-beta T cell proliferation	IEA
GO:2000564	Process	Regulation of CD8-positive, alpha-beta T cell proliferation	ISS

Other IDs

• MIM: 147575
• HGNC: 6116
• e!Ensembl: ENSG00000125347

Protein

• UniProt ID: P10914
• Protein name: Interferon regulatory factor 1 (IRF-1)
• Protein function: Transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses (PubMed:15226432, PubMed:15509808, PubMed:17516545, PubMed:17942705, PubMed:18497060, PubMed:19404407, PubMed:19851330, PubMed:223
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00605	IRF	7 → 112	Interferon regulatory factor transcription factor	Domain

• Sequence:

  MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
  HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
  KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT
  PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL
  LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
  MDATWLDSLLTPVRLPSIQAIPCAP

• Sequence length: 325

Pathways

KEGG:

C-type lectin receptor signaling pathway
TNF signaling pathway
Prolactin signaling pathway
Pertussis
Human papillomavirus infection

Reactome:

Interferon gamma signaling
Interferon alpha/beta signaling
Factors involved in megakaryocyte development and platelet production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Gastric cancer	Pathogenic	rs121912469	RCV000015840	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency 117	Pathogenic	rs2479457796, rs2479462097	RCV003482892 RCV003482893	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-small cell lung carcinoma	Pathogenic	rs121912470	RCV000015841	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRF1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	ClinVar, HPO ClinVar, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROSACEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	8219215		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	12374626		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	8438156		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	8634413		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10602416, 28039033		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30305853, 9679752		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16533423		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28977839		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	8564980		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8634413		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23487038		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	9649118		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34804058	Associate	★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	23335596		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27512062		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	27512062	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	30408130	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12499398, 21979142, 31367250		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27940139		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	11315919, 25540605	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21834067, 25014791, 25452308, 35572839	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22401175	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11069564, 11247662, 16961714, 24074333, 24824216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	12499398, 21979142, 31367250		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33755965	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	22096509	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	22053985		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29955164		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19345417	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20709399, 28453771, 28635960		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34314424	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17869652		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	17869652		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of stomach	Benign Neoplasm Of Stomach	CGI_DG			★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	17617740		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	33336753	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14565859, 15878912, 17498560, 19697121, 21817116, 26011589		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	11323500, 14651776, 14993214, 15241475, 16241857, 19697121, 20457620, 26011589, 32784074, 36936167, 37761960	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	9515585		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	31551920		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11711624, 19574175, 21389130, 32784074, 34158547	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26011589	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	10942060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18694960, 8536888		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17508019	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11323500	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21564420, 22056812, 27191889, 27279136, 31727135, 32016965, 32671843, 40612868	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of stomach	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30389502		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32558345	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22890831	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34789838	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24564251	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36478592	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	14599866		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24995581		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28150292	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	22053985		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12788988, 14675396, 28934294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	LHGDN	12788988, 14675396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	21288140	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	28934294	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	38277520	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	12374626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	14764039, 15710386, 16857162, 19574175, 25658920		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14764039, 15710386, 16857162, 19574175, 25658920		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	8634413		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	16961714, 29047170		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	9649118		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29107934, 30145803		★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	8219215	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	20031577	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19858727		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25208103, 31827213		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34158547, 38203518	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16530516		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25301365, 32925784	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30643462, 31827213		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25301365, 29720400, 33277837	Associate	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	32765497	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30370655, 9244230		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19032371		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25997853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	16724073, 17213842, 20031577, 21816865, 25208103		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20031577, 34749666, 39199011	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	24940638	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10930443		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24940638	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21858617, 22401175, 24657155		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	9442805		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36978091	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	9442805		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32210958	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28248954, 30269996, 9442805		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36978091, 37316538	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23487038, 26362649		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22995210		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	22995210	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28316372	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36481790	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	19764067		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31428517		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26362401		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26362401		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26362401		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33902005	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34643804, 36007277	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	36978091	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	22393348	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16195814		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	9244230		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30370655, 9244230		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21790247		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	21790247, 7687740	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	31668371		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	7936656		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	27310137	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	27866197		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23149563		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24927122, 25955133	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24927122	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28274199		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30082820		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	23029250		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22467146, 34758847	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	25208103		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	22053985		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	11315919, 17328074		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	10609788		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10662620		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10609788, 10807049, 7936656, 8438156, 8622878, 9315094		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18084608, 30898977	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	8704165	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11264190, 11559933, 12358902, 21740303, 21790247, 8219215, 8634413	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	32763828	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10602416, 11264190, 11559933, 12358902, 18575764, 21790247, 8219215, 8634413		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	8527387		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	8527387		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11289138, 11350897, 19858727, 22805863, 25617495, 27279136, 28098858, 31727135, 9824633		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19858727		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15476869, 25617495, 9824633		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35092496	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25418955, 25611806, 28564495, 31790472, 34847931, 36306362, 39818255	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32730703	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19710693, 24836587, 25418955, 28564495, 31104557		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	31507612	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32925784	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26362649		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	17140157		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14565859, 15878912, 17498560, 19697121, 20457620, 21817116, 26011589		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30485581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19056926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30389502		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24995581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24632547		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28905415		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19697121, 19851330, 27866197, 31113461, 31186404, 9679752		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11846974, 18472010, 21817116, 25497010, 29599126, 29720400, 30042418		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15710386, 16857162, 19574175, 25658920		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16530516		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14993214, 15548708, 15878912, 17498560		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19697121		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	9649118		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18511292, 20398276, 21197417, 28331615, 32316408, 39237877	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19032371, 20398276, 21964766, 31533832		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28416283		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21300955, 23149563		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28331615		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24886089		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	39672520	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	10602416		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35092496	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	21389130	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17300840, 35760800	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18922617		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11196707, 18338947, 18511806, 24657155, 31396345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18338947		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	18511806	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	11147573	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	18032730		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	10602416, 7936656, 8219215, 8438156, 8622878		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10602416, 10609788, 10654445, 10807049, 12358902, 18084608, 19345417, 21790247, 28113084, 7936656, 8219215, 8438156, 9315094		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	16483648		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	8219215		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12358902, 18084608, 19345417, 21790247	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	8219215	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12358902, 9204971		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	38277520	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	9244230		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	25098831	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27149165	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	27149165	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10391680, 10609788, 10654445, 10807049, 11264190, 11289138, 11350897, 11846974, 11973642, 12067985, 12499398, 12592391, 15241475, 15878912, 16371631, 16530516, 16533423, 17073600, 17498560, 17516545, 18472010, 18575764, 19697121, 19851330, 19858727, 19962964, 20435892, 20457620, 21368870, 21790247, 21816905, 22890831, 23785404, 24015294, 24632547, 24886089, 24995581, 25501823, 26011589, 27189167, 27279136, 27866197, 28494868, 28507795, 28592284, 29107934, 29112686, 30042418, 30117089, 30145803, 30251028, 30342302, 30485581, 31239318, 31439235, 31533832, 31590913, 31827213, 7936656, 8219215, 8267400, 8622878, 8795694, 9315094, 9669677, 9679752		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	15082491, 19345417, 8219215	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23071666		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23071666	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28977839, 30389502		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	22053985		★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	BEFREE	30305075		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	30305075		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28416283		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31337976		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31337976	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24995581		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10376977, 20717669, 27806724, 35820543	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24632547		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11454803, 35677632, 36952469	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	35835355	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28331615	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	32926429	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	22995210		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	22995210	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32210958, 37090158	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28068351		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28068351, 37140276	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28905415		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24886089	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17970693, 20031577		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	29673202		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19032371, 9088024		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22401175, 25014791, 25452308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	24768588	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	39567011	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37372943	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28849179		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	17075845, 29504848	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	24464587		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	22077067	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	22077067		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	24757137		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	19697121		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30305853		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30485581, 31173852		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35664436	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28977839		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	UNIPROT_DG	10395927, 9679752		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19851330, 27866197, 31113461, 31186404, 9679752		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19697121, 19851330, 20507321, 22531515, 23785404, 24927122, 27866197, 31113461, 31659258, 36519208, 37951921	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21805152	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38277520	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	21757724	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22489698, 27545642		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25208103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Calculi (disorder)	Urinary Bladder Calculi	BEFREE	31590913		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17617740	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	29510721		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10702232, 11739693, 19574175, 33076322	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	31025552, 34743576	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	36834715	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	15082491, 36797040	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	24732887		★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	31156620		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	31871426	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	28129744	Associate	★☆☆☆☆ Found in Text Mining only