Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3656
Gene name	Interleukin 1 receptor associated kinase 2
Gene symbol	IRAK2
Synonyms (NCBI Gene)	IRAK-2
Chromosome	3
Chromosome location	3p25.3
Summary	IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of

165

Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000304	hsa-miR-146a-5p	qRT-PCRWestern blot	20124483
MIRT017238	hsa-miR-335-5p	Microarray	18185580
MIRT000304	hsa-miR-146a-5p	qRT-PCRWestern blot	25889446
MIRT000304	hsa-miR-146a-5p	qRT-PCR	28077577
MIRT732913	hsa-miR-497-3p	ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32706167
MIRT732914	hsa-miR-16-5p	ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32706167
MIRT732915	hsa-miR-195-3p	ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32706167
MIRT732916	hsa-miR-15a-3p	ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32706167
MIRT732917	hsa-miR-15a-3p	ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32706167
MIRT000304	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT735385	hsa-miR-155-5p	qRT-PCR	31739406
MIRT1070424	hsa-miR-10a	CLIP-seq
MIRT1070425	hsa-miR-10b	CLIP-seq
MIRT1070426	hsa-miR-1244	CLIP-seq
MIRT1070427	hsa-miR-1264	CLIP-seq
MIRT1070428	hsa-miR-128	CLIP-seq
MIRT1070429	hsa-miR-1283	CLIP-seq
MIRT1070430	hsa-miR-1307	CLIP-seq
MIRT1070431	hsa-miR-134	CLIP-seq
MIRT1070432	hsa-miR-136	CLIP-seq
MIRT1070433	hsa-miR-150	CLIP-seq
MIRT1070434	hsa-miR-1972	CLIP-seq
MIRT1070435	hsa-miR-199a-3p	CLIP-seq
MIRT1070436	hsa-miR-199b-3p	CLIP-seq
MIRT1070437	hsa-miR-24	CLIP-seq
MIRT1070438	hsa-miR-2682	CLIP-seq
MIRT1070439	hsa-miR-3065-5p	CLIP-seq
MIRT1070440	hsa-miR-3118	CLIP-seq
MIRT1070441	hsa-miR-3129-5p	CLIP-seq
MIRT1070442	hsa-miR-3136-5p	CLIP-seq
MIRT1070443	hsa-miR-339-5p	CLIP-seq
MIRT1070444	hsa-miR-34a	CLIP-seq
MIRT1070445	hsa-miR-34b	CLIP-seq
MIRT1070446	hsa-miR-34c-5p	CLIP-seq
MIRT1070447	hsa-miR-3613-3p	CLIP-seq
MIRT1070448	hsa-miR-3675-3p	CLIP-seq
MIRT1070449	hsa-miR-4269	CLIP-seq
MIRT1070450	hsa-miR-4284	CLIP-seq
MIRT1070451	hsa-miR-4330	CLIP-seq
MIRT1070452	hsa-miR-4421	CLIP-seq
MIRT1070453	hsa-miR-4427	CLIP-seq
MIRT1070454	hsa-miR-4439	CLIP-seq
MIRT1070455	hsa-miR-4466	CLIP-seq
MIRT1070456	hsa-miR-449a	CLIP-seq
MIRT1070457	hsa-miR-449b	CLIP-seq
MIRT1070458	hsa-miR-449c	CLIP-seq
MIRT1070459	hsa-miR-4502	CLIP-seq
MIRT1070460	hsa-miR-4513	CLIP-seq
MIRT1070461	hsa-miR-4514	CLIP-seq
MIRT1070462	hsa-miR-4638-5p	CLIP-seq
MIRT1070463	hsa-miR-4645-5p	CLIP-seq
MIRT1070464	hsa-miR-4665-3p	CLIP-seq
MIRT1070465	hsa-miR-4673	CLIP-seq
MIRT1070466	hsa-miR-4684-5p	CLIP-seq
MIRT1070467	hsa-miR-4692	CLIP-seq
MIRT1070468	hsa-miR-4731-3p	CLIP-seq
MIRT1070469	hsa-miR-4746-3p	CLIP-seq
MIRT1070470	hsa-miR-4755-3p	CLIP-seq
MIRT1070471	hsa-miR-4801	CLIP-seq
MIRT1070472	hsa-miR-488	CLIP-seq
MIRT1070473	hsa-miR-526b	CLIP-seq
MIRT1070474	hsa-miR-578	CLIP-seq
MIRT1070475	hsa-miR-593	CLIP-seq
MIRT1070476	hsa-miR-675	CLIP-seq
MIRT1070477	hsa-miR-936	CLIP-seq
MIRT1070478	hsa-miR-944	CLIP-seq
MIRT1070445	hsa-miR-34b	CLIP-seq
MIRT2017314	hsa-miR-1227	CLIP-seq
MIRT1070426	hsa-miR-1244	CLIP-seq
MIRT1070435	hsa-miR-199a-3p	CLIP-seq
MIRT1070436	hsa-miR-199b-3p	CLIP-seq
MIRT1070441	hsa-miR-3129-5p	CLIP-seq
MIRT2017315	hsa-miR-3160-3p	CLIP-seq
MIRT1070445	hsa-miR-34b	CLIP-seq
MIRT2017316	hsa-miR-4252	CLIP-seq
MIRT2017317	hsa-miR-4327	CLIP-seq
MIRT2017318	hsa-miR-4329	CLIP-seq
MIRT2017319	hsa-miR-4487	CLIP-seq
MIRT2017320	hsa-miR-4511	CLIP-seq
MIRT1070468	hsa-miR-4731-3p	CLIP-seq
MIRT2017321	hsa-miR-4733-5p	CLIP-seq
MIRT2017322	hsa-miR-4793-3p	CLIP-seq
MIRT1070471	hsa-miR-4801	CLIP-seq
MIRT2017323	hsa-miR-510	CLIP-seq
MIRT2017324	hsa-miR-520g	CLIP-seq
MIRT2017325	hsa-miR-548ah	CLIP-seq
MIRT2017326	hsa-miR-558	CLIP-seq
MIRT2017327	hsa-miR-766	CLIP-seq
MIRT1070477	hsa-miR-936	CLIP-seq
MIRT2017314	hsa-miR-1227	CLIP-seq
MIRT1070435	hsa-miR-199a-3p	CLIP-seq
MIRT1070436	hsa-miR-199b-3p	CLIP-seq
MIRT1070441	hsa-miR-3129-5p	CLIP-seq
MIRT2017315	hsa-miR-3160-3p	CLIP-seq
MIRT2017316	hsa-miR-4252	CLIP-seq
MIRT2017318	hsa-miR-4329	CLIP-seq
MIRT2017319	hsa-miR-4487	CLIP-seq
MIRT2017320	hsa-miR-4511	CLIP-seq
MIRT2249219	hsa-miR-4717-5p	CLIP-seq
MIRT1070468	hsa-miR-4731-3p	CLIP-seq
MIRT2017321	hsa-miR-4733-5p	CLIP-seq
MIRT2017322	hsa-miR-4793-3p	CLIP-seq
MIRT1070471	hsa-miR-4801	CLIP-seq
MIRT2017324	hsa-miR-520g	CLIP-seq
MIRT2017325	hsa-miR-548ah	CLIP-seq
MIRT2017326	hsa-miR-558	CLIP-seq
MIRT2017327	hsa-miR-766	CLIP-seq
MIRT1070477	hsa-miR-936	CLIP-seq
MIRT1070426	hsa-miR-1244	CLIP-seq
MIRT1070435	hsa-miR-199a-3p	CLIP-seq
MIRT1070436	hsa-miR-199b-3p	CLIP-seq
MIRT1070441	hsa-miR-3129-5p	CLIP-seq
MIRT2389468	hsa-miR-3926	CLIP-seq
MIRT2389469	hsa-miR-4786-5p	CLIP-seq
MIRT2389470	hsa-miR-548s	CLIP-seq
MIRT1070477	hsa-miR-936	CLIP-seq
MIRT2451923	hsa-miR-3120-5p	CLIP-seq
MIRT1070447	hsa-miR-3613-3p	CLIP-seq
MIRT2451924	hsa-miR-371-5p	CLIP-seq
MIRT2451925	hsa-miR-371b-5p	CLIP-seq
MIRT2451926	hsa-miR-495	CLIP-seq
MIRT2451923	hsa-miR-3120-5p	CLIP-seq
MIRT1070447	hsa-miR-3613-3p	CLIP-seq
MIRT2451924	hsa-miR-371-5p	CLIP-seq
MIRT2451925	hsa-miR-371b-5p	CLIP-seq
MIRT2451926	hsa-miR-495	CLIP-seq
MIRT1070424	hsa-miR-10a	CLIP-seq
MIRT1070425	hsa-miR-10b	CLIP-seq
MIRT1070429	hsa-miR-1283	CLIP-seq
MIRT2451923	hsa-miR-3120-5p	CLIP-seq
MIRT1070443	hsa-miR-339-5p	CLIP-seq
MIRT1070447	hsa-miR-3613-3p	CLIP-seq
MIRT1070448	hsa-miR-3675-3p	CLIP-seq
MIRT2451924	hsa-miR-371-5p	CLIP-seq
MIRT2451925	hsa-miR-371b-5p	CLIP-seq
MIRT1070452	hsa-miR-4421	CLIP-seq
MIRT1070466	hsa-miR-4684-5p	CLIP-seq
MIRT2451926	hsa-miR-495	CLIP-seq
MIRT2552762	hsa-miR-548ac	CLIP-seq
MIRT2552763	hsa-miR-548ae	CLIP-seq
MIRT2552764	hsa-miR-548aj	CLIP-seq
MIRT2552765	hsa-miR-548am	CLIP-seq
MIRT2552766	hsa-miR-548d-3p	CLIP-seq
MIRT2552767	hsa-miR-548x	CLIP-seq
MIRT2552768	hsa-miR-548z	CLIP-seq
MIRT1070475	hsa-miR-593	CLIP-seq
MIRT1070429	hsa-miR-1283	CLIP-seq
MIRT2451923	hsa-miR-3120-5p	CLIP-seq
MIRT1070447	hsa-miR-3613-3p	CLIP-seq
MIRT1070448	hsa-miR-3675-3p	CLIP-seq
MIRT2451924	hsa-miR-371-5p	CLIP-seq
MIRT2451925	hsa-miR-371b-5p	CLIP-seq
MIRT1070466	hsa-miR-4684-5p	CLIP-seq
MIRT2017322	hsa-miR-4793-3p	CLIP-seq
MIRT2451926	hsa-miR-495	CLIP-seq
MIRT2017324	hsa-miR-520g	CLIP-seq
MIRT2552762	hsa-miR-548ac	CLIP-seq
MIRT2552763	hsa-miR-548ae	CLIP-seq
MIRT2017325	hsa-miR-548ah	CLIP-seq
MIRT2552764	hsa-miR-548aj	CLIP-seq
MIRT2552765	hsa-miR-548am	CLIP-seq
MIRT2552766	hsa-miR-548d-3p	CLIP-seq
MIRT2552767	hsa-miR-548x	CLIP-seq
MIRT2552768	hsa-miR-548z	CLIP-seq
MIRT2017327	hsa-miR-766	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CTCF	Unknown	15670593

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001959	Process	Regulation of cytokine-mediated signaling pathway	IMP	10383454
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS	10383454
GO:0004672	Function	Protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11544529, 18636090, 20485341, 21903422, 21988832, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	17878161
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	TAS	9374458
GO:0006954	Process	Inflammatory response	TAS	9374458
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	9252186, 19675569
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	17878161
GO:0007249	Process	Canonical NF-kappaB signal transduction	TAS	9374458
GO:0008063	Process	Toll signaling pathway	IBA
GO:0010008	Component	Endosome membrane	TAS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	7479976, 25355951, 25371197, 26189595
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	17878161
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035591	Function	Signaling adaptor activity	IDA	17878161
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	12048232, 19675569, 26189595
GO:0042803	Function	Protein homodimerization activity	IPI	10383454
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	10383454
GO:0046982	Function	Protein heterodimerization activity	IPI	10383454
GO:0060090	Function	Molecular adaptor activity	IDA	17878161
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IBA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	10383454
GO:0070555	Process	Response to interleukin-1	IMP	10383454

MIM	HGNC	e!Ensembl
603304	6113	ENSG00000134070

O43187

Protein name

Interleukin-1 receptor-associated kinase-like 2 (IRAK-2)

Protein function

Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization.

PDB

3MOP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00531	Death	13 → 94	Death domain	Domain
PF00069	Pkinase	210 → 461	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in spleen, thymus, prostate, lung, liver, skeletal muscle, kidney, pancreas and peripheral blood leukocytes. {ECO:0000269|PubMed:9374458}.

Sequence

MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP

Sequence length

625

Interactions

View interactions

	KEGG		Reactome
	Neurotrophin signaling pathway Tuberculosis		MyD88:MAL(TIRAP) cascade initiated on plasma membrane NOD1/2 Signaling Pathway TAK1 activates NFkB by phosphorylation and activation of IKKs complex activated TAK1 mediates p38 MAPK activation JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 Interleukin-1 signaling IRAK2 mediated activation of TAK1 complex TRAF6-mediated induction of TAK1 complex within TLR4 complex TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation MyD88 dependent cascade initiated on endosome IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation MyD88 cascade initiated on plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20937840	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35588430, 39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28223794	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	37108068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Candidemia	Candidemia	Pubtator	39299377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29753111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26133168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24973222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23188791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22151743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	22151743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31073143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	36194576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31650390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	39299377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29753111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	37108068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35561450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	18508790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	18508790	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29978465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33248223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	18508790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	18508790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23384071, 36194576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28223794	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29129009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37108068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25232259		★★★★★ ★☆☆☆☆ Found in Text Mining only

IRAK2 (interleukin 1 receptor associated kinase 2)