Gene Gene information from NCBI Gene database.
Entrez ID 3656
Gene name Interleukin 1 receptor associated kinase 2
Gene symbol IRAK2
Synonyms (NCBI Gene)
IRAK-2
Chromosome 3
Chromosome location 3p25.3
Summary IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of
miRNA miRNA information provided by mirtarbase database.
165
miRTarBase ID miRNA Experiments Reference
MIRT000304 hsa-miR-146a-5p qRT-PCRWestern blot 20124483
MIRT017238 hsa-miR-335-5p Microarray 18185580
MIRT000304 hsa-miR-146a-5p qRT-PCRWestern blot 25889446
MIRT000304 hsa-miR-146a-5p qRT-PCR 28077577
MIRT732913 hsa-miR-497-3p ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting 32706167
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
CTCF Unknown 15670593
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001959 Process Regulation of cytokine-mediated signaling pathway IMP 10383454
GO:0002755 Process MyD88-dependent toll-like receptor signaling pathway TAS 10383454
GO:0004672 Function Protein kinase activity IEA
GO:0005515 Function Protein binding IPI 11544529, 18636090, 20485341, 21903422, 21988832, 28514442, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603304 6113 ENSG00000134070
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43187
Protein name Interleukin-1 receptor-associated kinase-like 2 (IRAK-2)
Protein function Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization.
PDB 3MOP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00531 Death 13 94 Death domain Domain
PF00069 Pkinase 210 461 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, thymus, prostate, lung, liver, skeletal muscle, kidney, pancreas and peripheral blood leukocytes. {ECO:0000269|PubMed:9374458}.
Sequence
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWK
PAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEK
GAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP
Sequence length 625
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Neurotrophin signaling pathway
Tuberculosis
  MyD88:MAL(TIRAP) cascade initiated on plasma membrane
NOD1/2 Signaling Pathway
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
activated TAK1 mediates p38 MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
Interleukin-1 signaling
IRAK2 mediated activation of TAK1 complex
TRAF6-mediated induction of TAK1 complex within TLR4 complex
TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
MyD88 dependent cascade initiated on endosome
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
MyD88 cascade initiated on plasma membrane
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 20937840 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 35588430, 39342401 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 28223794 Stimulate
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone disease Pubtator 37108068 Associate
★☆☆☆☆
Found in Text Mining only
Candidemia Candidemia Pubtator 39299377 Associate
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 29753111
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic neoplasm Pubtator 26133168 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 24973222
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease Pubtator 23188791 Associate
★☆☆☆☆
Found in Text Mining only