EIF3E (eukaryotic translation initiation factor 3 subunit E)

Gene

• Entrez ID: 3646
• Gene name: Eukaryotic translation initiation factor 3 subunit E
• Gene symbol: EIF3E
• Synonyms (NCBI Gene): EIF3-P48, EIF3S6, INT6, eIF3-p46
• Chromosome: 8
• Chromosome location: 8q23.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020499	hsa-miR-155-5p	Proteomics	18668040
MIRT031475	hsa-miR-16-5p	Proteomics	18668040
MIRT049969	hsa-miR-29a-3p	CLASH	23622248
MIRT639798	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639797	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT440738	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440738	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT639798	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639797	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT957563	hsa-miR-224	CLIP-seq
MIRT957564	hsa-miR-3620	CLIP-seq
MIRT957565	hsa-miR-369-3p	CLIP-seq
MIRT957566	hsa-miR-374a	CLIP-seq
MIRT957567	hsa-miR-374b	CLIP-seq
MIRT957568	hsa-miR-410	CLIP-seq
MIRT957569	hsa-miR-4282	CLIP-seq
MIRT957570	hsa-miR-4517	CLIP-seq
MIRT957571	hsa-miR-4698	CLIP-seq
MIRT957572	hsa-miR-4781-3p	CLIP-seq
MIRT957573	hsa-miR-4795-3p	CLIP-seq
MIRT957574	hsa-miR-584	CLIP-seq
MIRT957575	hsa-miR-590-3p	CLIP-seq
MIRT957576	hsa-miR-633	CLIP-seq
MIRT957563	hsa-miR-224	CLIP-seq
MIRT957564	hsa-miR-3620	CLIP-seq
MIRT957568	hsa-miR-410	CLIP-seq
MIRT957569	hsa-miR-4282	CLIP-seq
MIRT957570	hsa-miR-4517	CLIP-seq
MIRT957571	hsa-miR-4698	CLIP-seq
MIRT957572	hsa-miR-4781-3p	CLIP-seq
MIRT957570	hsa-miR-4517	CLIP-seq
MIRT957571	hsa-miR-4698	CLIP-seq
MIRT957572	hsa-miR-4781-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IMP	17468741
GO:0000785	Component	Chromatin	NAS	17468741
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IC	9295280
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10504338, 16189514, 17324924, 17468741, 18599441, 18628297, 19748344, 20890303, 21745818, 21988832, 22190034, 23623729, 24705354, 25416956, 26496610, 28514442, 30833792, 31515488, 32296183, 32814053, 33961781, 35271311, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10504338
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	NAS	17468741
GO:0005737	Component	Cytoplasm	IDA	10504338
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	9295280, 17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	NAS	10504338
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632
GO:0006413	Process	Translational initiation	IEA
GO:0006446	Process	Regulation of translational initiation	ISS
GO:0006446	Process	Regulation of translational initiation	NAS	9295280, 17468741
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0016605	Component	PML body	IDA	10504338
GO:0016605	Component	PML body	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045727	Process	Positive regulation of translation	IPI	24092755
GO:0045947	Process	Negative regulation of translational initiation	NAS	10504338
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071540	Component	Eukaryotic translation initiation factor 3 complex, eIF3e	IEA

Other IDs

• MIM: 602210
• HGNC: 3277
• e!Ensembl: ENSG00000104408

Protein

• UniProt ID: P60228
• Protein name: Eukaryotic translation initiation factor 3 subunit E (eIF3e) (Eukaryotic translation initiation factor 3 subunit 6) (Viral integration site protein INT-6 homolog) (eIF-3 p48)
• Protein function: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40
• PDB: 3J8B, 3J8C, 6FEC, 6YBD, 6ZMW, 6ZON, 6ZP4, 6ZVJ, 7A09, 7QP6, 7QP7, 8OZ0, 8PJ1, 8PJ2, 8PJ3, 8PJ4, 8PJ5, 8PJ6, 8PPL, 8RG0, 8XXN, 9BLN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09440	eIF3_N	5 → 138	eIF3 subunit 6 N terminal domain	Domain
  PF01399	PCI	290 → 395	PCI domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at highest levels in appendix, lymph, pancreas, skeletal muscle, spleen and thymus. {ECO:0000269|PubMed:8688078, ECO:0000269|PubMed:9295280}.
• Sequence:

  MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKN
  LYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK
  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ
  NWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP
  QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
  VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL
  NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
  NIEKKLNQNSRSEAPNWATQDSGFY

• Sequence length: 445

Pathways

KEGG:

Hepatitis C

Reactome:

L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	11115556		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	21379329		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	29146897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27451077		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	17324924, 20713899, 22960363		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11115556, 17187232, 17626637, 20453879, 22907435, 27550454, 9403073		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11121040, 22508697, 26056130	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27550454	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11071922, 11121040, 22508697, 25123227	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11115556		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27451077		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26056130		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25400724		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17385060, 25400724		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25400724	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24847761, 25531322, 30916365		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15750208	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25400724	Stimulate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	GWASCAT_DG	21732829, 28886342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren Contracture	Dupuytren contracture	Pubtator	21732829, 34573275	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren`s Disease	Dupuytren Contracture	GWASDB_DG	21732829		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29895936		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28438065		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24481065		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24481065	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24481065		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11115556		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15867213		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36116043	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25400724	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11115556, 17187232, 20453879, 22907435, 27550454		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24847761, 26056130		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27451077		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11115556, 15030549, 17324924, 20453879, 27550454, 27814599		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25400724		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11115556, 17324924, 9403073		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11115556, 15867213, 17187232, 17324924, 17626637, 21672358, 22907435, 22960363, 25400724, 27814599, 8738604, 9334290, 9403073		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11115556, 15867213, 26056130		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29675094		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21672358	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27814599		★☆☆☆☆ Found in Text Mining only