Gene Gene information from NCBI Gene database.
Entrez ID 3641
Gene name Insulin like 4
Gene symbol INSL4
Synonyms (NCBI Gene)
EPILPLACENTIN
Chromosome 9
Chromosome location 9p24.1
Summary INSL4 encodes the insulin-like 4 protein, a member of the insulin superfamily. INSL4 encodes a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or
miRNA miRNA information provided by mirtarbase database.
19
miRTarBase ID miRNA Experiments Reference
MIRT030220 hsa-miR-26b-5p Microarray 19088304
MIRT532329 hsa-miR-8084 PAR-CLIP 22012620
MIRT532328 hsa-miR-580-5p PAR-CLIP 22012620
MIRT532327 hsa-miR-494-3p PAR-CLIP 22012620
MIRT532326 hsa-miR-1257 PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 8702754
GO:0005159 Function Insulin-like growth factor receptor binding TAS 8666396
GO:0005179 Function Hormone activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space TAS 8702754
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600910 6087 ENSG00000120211
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14641
Protein name Early placenta insulin-like peptide (EPIL) (Insulin-like peptide 4) (Placentin) [Cleaved into: Early placenta insulin-like peptide B chain; Early placenta insulin-like peptide A chain]
Protein function May play an important role in trophoblast development and in the regulation of bone formation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells. {ECO:0000269|PubMed:12414911, ECO:0000269|PubMed:974031
Sequence
MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLE
SGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRF
DPFCCEVICDDGTSVKLCT
Sequence length 139
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CLONAL HEMATOPOIESIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30423141
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 30423141
★☆☆☆☆
Found in Text Mining only
Choriocarcinoma Choriocarcinoma BEFREE 12414911
★☆☆☆☆
Found in Text Mining only
Down Syndrome Down Syndrome BEFREE 11061561
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 30423141
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 30423141
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms Mammary Neoplasms LHGDN 18035692
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 30423141
★☆☆☆☆
Found in Text Mining only
Neurofibromatosis, Type 3, mixed central and peripheral Neurofibromatosis BEFREE 26430762
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 30423141
★☆☆☆☆
Found in Text Mining only