INPP5D (inositol polyphosphate-5-phosphatase D)

Gene

• Entrez ID: 3635
• Gene name: Inositol polyphosphate-5-phosphatase D
• Gene symbol: INPP5D
• Synonyms (NCBI Gene): SHIP, SHIP-1, SHIP1, SIP-145, hp51CN, p150Ship
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	Luciferase reporter assay, Western blot	20041145
MIRT000631	hsa-miR-155-5p	Luciferase reporter assay	19359473
MIRT000631	hsa-miR-155-5p	Review	20144731
MIRT000631	hsa-miR-155-5p	Review	20029422
MIRT000631	hsa-miR-155-5p	GFP reporter assay, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	19641183
MIRT000631	hsa-miR-155-5p	Reporter assay	20041145
MIRT000631	hsa-miR-155-5p	Reporter assay;Western blot;qRT-PCR;Other	19359473
MIRT030268	hsa-miR-26b-5p	Microarray	19088304
MIRT038735	hsa-miR-93-3p	CLASH	23622248
MIRT000631	hsa-miR-155-5p	qRT-PCR, Western blot	22982040
MIRT000631	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	24522920
MIRT000631	hsa-miR-155-5p	EMSA, Flow, Luciferase reporter assay, qRT-PCR, Western blot	25971362
MIRT000631	hsa-miR-155-5p	qRT-PCR	36071352
MIRT1067364	hsa-miR-1271	CLIP-seq
MIRT1067365	hsa-miR-3614-5p	CLIP-seq
MIRT1067366	hsa-miR-3659	CLIP-seq
MIRT1067367	hsa-miR-4255	CLIP-seq
MIRT1067368	hsa-miR-4658	CLIP-seq
MIRT1067369	hsa-miR-574-5p	CLIP-seq
MIRT1067370	hsa-miR-96	CLIP-seq
MIRT1067371	hsa-miR-214	CLIP-seq
MIRT1067372	hsa-miR-3619-5p	CLIP-seq
MIRT1067373	hsa-miR-4281	CLIP-seq
MIRT1067374	hsa-miR-4449	CLIP-seq
MIRT1067375	hsa-miR-4459	CLIP-seq
MIRT1067376	hsa-miR-4530	CLIP-seq
MIRT1067377	hsa-miR-4722-5p	CLIP-seq
MIRT1067378	hsa-miR-761	CLIP-seq
MIRT1067379	hsa-miR-765	CLIP-seq
MIRT2016314	hsa-miR-4795-3p	CLIP-seq
MIRT2016315	hsa-miR-329	CLIP-seq
MIRT2016316	hsa-miR-362-3p	CLIP-seq
MIRT2248618	hsa-miR-3616-3p	CLIP-seq
MIRT2248619	hsa-miR-4779	CLIP-seq
MIRT1067375	hsa-miR-4459	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004439	Function	Phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA
GO:0004445	Function	Inositol-polyphosphate 5-phosphatase activity	IDA	10764818
GO:0004445	Function	Inositol-polyphosphate 5-phosphatase activity	IEA
GO:0004445	Function	Inositol-polyphosphate 5-phosphatase activity	TAS	8769125
GO:0005515	Function	Protein binding	IPI	9148918, 9485206, 10382761, 15090612, 16339535, 19843936, 20933011, 21712384, 24642916, 25416956, 26221972, 26755705, 32296183
GO:0005737	Component	Cytoplasm	IDA	10822173
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006661	Process	Phosphatidylinositol biosynthetic process	IEA
GO:0006661	Process	Phosphatidylinositol biosynthetic process	TAS
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	8769125
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	8769125
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0009968	Process	Negative regulation of signal transduction	IBA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0016314	Function	Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030853	Process	Negative regulation of granulocyte differentiation	IEA
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0034485	Function	Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity	IEA
GO:0034485	Function	Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity	TAS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	36248894
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045579	Process	Positive regulation of B cell differentiation	IBA
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045656	Process	Negative regulation of monocyte differentiation	IEA
GO:0045659	Process	Negative regulation of neutrophil differentiation	IBA
GO:0045659	Process	Negative regulation of neutrophil differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045779	Process	Negative regulation of bone resorption	IBA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388
GO:0046856	Process	Phosphatidylinositol dephosphorylation	IEA
GO:0050776	Process	Regulation of immune response	IBA
GO:0050777	Process	Negative regulation of immune response	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0052659	Function	Inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity	IEA

Other IDs

• MIM: 601582
• HGNC: 6079
• e!Ensembl: ENSG00000168918

Protein

• UniProt ID: Q92835
• Protein name: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 (EC 3.1.3.86) (Inositol polyphosphate-5-phosphatase D) (EC 3.1.3.56) (Inositol polyphosphate-5-phosphatase of 145 kDa) (SIP-145) (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase) (EC 3.1.3.36) (
• Protein function: Phosphatidylinositol (PtdIns) phosphatase that specifically hydrolyzes the 5-phosphate of phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3) to produce PtdIns(3,4)P2, thereby negatively regulating the PI3K (phosphoinositide 3-kinase) pat
• PDB: 2YSX, 5RW2, 5RW3, 5RW4, 5RW5, 5RW6, 5RW7, 5RW8, 5RW9, 5RWA, 5RWB, 5RWC, 5RWD, 5RWE, 5RWF, 5RWG, 5RWH, 5RWI, 5RWJ, 5RWK, 5RWL, 5RWM, 5RWN, 5RWO, 5RWP, 5RWQ, 5RWR, 5RWS, 5RWT, 5RWU, 5RWV, 5RWW, 5RWX, 5RWY, 5RWZ, 5RX0, 5RX1, 5RX2, 5RX3, 5RX4, 5RX5, 5RX6, 5RX7, 5RX8, 5RX9, 5RXA, 5RXB, 5RXC, 5RXD, 5RXE, 5RXF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	5 → 86	SH2 domain	Domain
  PF03372	Exo_endo_phos	409 → 701	Endonuclease/Exonuclease/phosphatase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in immune and hematopoietic cells. Expressed in bone marrow and blood cells. Levels vary considerably within this compartment. Present in at least 74% of immature CD34+ cells, whereas within the more mature popul
• Sequence:

  MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
  DKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESV
  VSPPELPPRNIPLTASSCEAKEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEH
  LKAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELYGEVIRTLPSLESLQRLFDQ
  QLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRPSLIPPVT
  FEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVIL
  VETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK
  KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTV
  AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNS
  HLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAE
  TIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQK
  ATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKN
  GPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKF
  GETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH
  GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAP
  PCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGES
  PPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENP
  LYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPA
  PRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPR
  PPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ

• Sequence length: 1189

Pathways

KEGG:

Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis

Reactome:

Synthesis of PIPs at the plasma membrane
Synthesis of IP3 and IP4 in the cytosol
Downstream TCR signaling
PECAM1 interactions
Interleukin receptor SHC signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE COMBINED IMMUNODEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe combined immunodeficiency disease	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	30320580		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	12529653		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25799995, 30045148		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29143813, 29852247		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25114068, 28005991, 28199971, 31319229, 35139885, 36334414, 38016942	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	36981033	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	30320580		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	27750211		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	30320580		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	24162737		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	24162737, 29777097, 30617256		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	30320580		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	30320580		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29309817		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18327256, 29517392		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18327256, 29517392		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30910708		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	30662663		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28972092, 29018171, 29681901, 31076529		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19890474, 29143813, 29925063		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30539826		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19473701	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30720128		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21999375, 24352714		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	31090511		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	26011644		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	26503814		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29708507		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	16428799		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27395764, 28246471		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29018171		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26226011, 26481854, 28767696, 29345374, 29872435, 30760087		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28767696	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21282106		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21282106	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21690378		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31780579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	33901562	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27701716, 31076529		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19890474		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	Pubtator	28619727	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	30045148		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	30320580		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	26993346		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21917890		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	17312133		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30720128		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	23468366	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	21917890	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25961455	Associate	★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	28767696, 29872435, 30760087		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28482637		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27395764, 29872435		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31090511		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	17268534		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30715692		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16351639, 22820502		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35412895	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15470047, 35412895	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12529653, 19148132, 22820502, 25175984, 29143813, 29852247		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28165501		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	21917890	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	39176091	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31076529		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30539826		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22955914, 29018171		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30539826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30720128		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12529653, 21155837, 21672530, 22033675, 26785143, 31831562		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29018171		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23443536		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22033675		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23469041	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22249254		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10194451, 12829595		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17268534, 17371259		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12529653, 23443536, 29143813, 29309817, 29780388, 29852247, 31831562		★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	15470047	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28732187		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30720128		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	7761412, 9593760		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28732187, 29926501, 29926940		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30045148		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30045148		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	19473701		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	30320580		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28658529		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21690378		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	19148132, 29143813		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36923408	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27584795	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	27584795		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23468366	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29872435		★☆☆☆☆ Found in Text Mining only