CXCL10 (C-X-C motif chemokine ligand 10)

Gene

• Entrez ID: 3627
• Gene name: C-X-C motif chemokine ligand 10
• Gene symbol: CXCL10
• Synonyms (NCBI Gene): C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1
• Chromosome: 4
• Chromosome location: 4q21.1
• Summary: This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438112	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438109	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438110	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438108	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438112	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438109	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438110	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438108	hsa-miR-21-5p	qRT-PCR	24889251
MIRT659959	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT659958	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT659957	hsa-miR-4288	HITS-CLIP	23824327
MIRT659956	hsa-miR-632	HITS-CLIP	23824327
MIRT659955	hsa-miR-1231	HITS-CLIP	23824327
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540508	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT737638	hsa-miR-15a-5p	Luciferase reporter assay	26845678
MIRT731341	hsa-miR-15a-5p	Luciferase reporter assay	26845678
MIRT733146	hsa-miR-155-5p	qRT-PCR	31766503
MIRT733147	hsa-miR-34a-5p	qRT-PCR	31766503
MIRT733147	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry, ELISA	33229509
MIRT736411	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT659959	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT659958	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT659957	hsa-miR-4288	HITS-CLIP	23824327
MIRT659956	hsa-miR-632	HITS-CLIP	23824327
MIRT659955	hsa-miR-1231	HITS-CLIP	23824327
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540508	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT755530	hsa-miR-149-3p	qRT-PCR	36250208
MIRT2207912	hsa-miR-4716-5p	CLIP-seq
MIRT2435120	hsa-miR-570	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Activation	19342664
IRF3	Activation	18691624;24257594
IRF7	Activation	24701034
NFKB1	Activation	16982926;20164184;24701034
NFKB1	Unknown	16818736;19479051;24257594
RELA	Activation	16982926;20164184;24701034
RELA	Unknown	16818736;19479051;24257594
STAT1	Repression	22022583
STAT1	Unknown	19479051;23153456

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IEA
GO:0005102	Function	Signaling receptor binding	TAS	10201891
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	18275857, 21314817, 28381538
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IDA	12782716
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10903763
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10903763
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	10201891
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10903763
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	12782716
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12782716
GO:0007267	Process	Cell-cell signaling	TAS	3925348
GO:0007517	Process	Muscle organ development	TAS	8798675
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	12782716
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10903763
GO:0008015	Process	Blood circulation	TAS	8798675
GO:0008201	Function	Heparin binding	IMP	18645041
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8798675
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	TAS	10903763
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010818	Process	T cell chemotaxis	IMP	18645041
GO:0010819	Process	Regulation of T cell chemotaxis	IDA	8608232
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	7540647
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033280	Process	Response to vitamin D	IEA
GO:0034605	Process	Cellular response to heat	IEA
GO:0042056	Function	Chemoattractant activity	IDA	11157474
GO:0042118	Process	Endothelial cell activation	IGI	19470579
GO:0042127	Process	Regulation of cell population proliferation	IDA	12782716
GO:0042981	Process	Regulation of apoptotic process	IDA	22652417
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	12782716
GO:0048248	Function	CXCR3 chemokine receptor binding	IDA	12782716
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	12782716
GO:0051607	Process	Defense response to virus	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IMP	18645041
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	23776175
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	8608232
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0098586	Process	Cellular response to virus	IEP	28146100
GO:0140374	Process	Antiviral innate immune response	IEP	25930096
GO:1901509	Process	Regulation of endothelial tube morphogenesis	IDA	16484616
GO:1901740	Process	Negative regulation of myoblast fusion	IEA
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790

Other IDs

• MIM: 147310
• HGNC: 10637
• e!Ensembl: ENSG00000169245

Protein

• UniProt ID: P02778
• Protein name: C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10) [Cleaved into: CXCL10(1-73)]
• Protein function: Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (PubMed:11157474
• PDB: 1LV9, 1O7Y, 1O7Z, 1O80, 8K2X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	28 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus (PubMed:11157474). Microglial cells produce CXCL10 in response to viral stimulation (PubMed:12663757). {ECO:0000269|PubMed:
• Sequence:

  MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
  EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

• Sequence length: 98

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
IL-17 signaling pathway
TNF signaling pathway
Hepatitis C
Influenza A
Epstein-Barr virus infection
Coronavirus disease - COVID-19

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTITIS, INTERSTITIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL CYSTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22058116		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	22989785		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31221150		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25415223		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	22989785		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27943355		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12115499, 15751051		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28487565, 30101523		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28438165, 28765149, 30552890		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	12608917		★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	23408864, 35320431	Associate	★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	27863395		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28717357		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	CTD_human_DG	22358057		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23922745, 29439331, 30092003, 30336198, 36569892	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29223680	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27776263		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	15307136, 28401489, 28446581		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23085936		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29592817	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36737740	Stimulate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25212604		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	27546026		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22674409, 32411797	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	22674409, 30006250		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	23887838	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22576056, 24884871, 25415223, 30685120, 31415645		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	30185417		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	38484620	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28654700		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	23200757, 28411045		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	31615548		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21850543, 24868552		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	100562, 17265155, 19109154, 23092582, 28724396, 29378189, 29968810		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16507178, 16846531	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17393419	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	14579283	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15743470, 16507178	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	17374135	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11310827, 27964744, 35095831	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16323244, 16846531	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11178128, 12718750, 12932287, 16846531, 18505427, 20604932, 20709179, 21255008, 21708014, 21953607, 22401175, 26367725, 26711533, 28148302, 31275320, 31652652, 33387195, 33387686, 36911710, 40238799	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33879239	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	27389865		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15696082, 15764644, 15944327, 17302903, 22387292, 24153332, 25272186, 27955890, 28275176, 28679952, 29411555, 29413515, 30323811, 31061143, 31550242		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	15879427, 15944327, 17628646		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17302903, 19643938	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18684970, 24153332, 26344080	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21054674, 22004287, 22132893, 22387292, 23760409, 30864351, 35143808, 35791991, 37029363, 38253462	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24630834, 25591911, 27461653		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27461653	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	31568628	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17591977, 17991878, 25073092, 32954739, 38152968	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21850543, 24868552		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34572567	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	34721402	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34128902	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	11207658, 30557999		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	16846531, 16931519, 30250011	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	18379127		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19105984, 19410617, 19641142, 20153790, 24977661, 27637385, 28411045, 29449068, 30250011		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	LHGDN	15745922, 18702954		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	20929277, 24977661, 28674524, 28698095, 31485460, 31813786		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	15307136, 28401489, 28446581		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	31399711		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	17056573	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25982097, 29116188		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	25982097, 29116188	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	24894780	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	11418676		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	16243485		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	18422935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16094077, 31277459		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	26293297	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	29932457	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29438197		★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	24339874	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	36459652	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	36539847	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	30355926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	26277786	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	15081542		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	23213058		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15081542, 17018607, 26079660, 27002757, 28209986, 29689563, 30177620, 31054033, 31544897		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18632641, 22333315, 23213058, 23370279, 27002757, 29685151, 30177620, 30579865, 31544897, 34504204, 34572567, 34693792, 34871062, 35819135, 37977037	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29495008, 29689563	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	29688024	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	16709871, 30781765		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27637385		★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	26176954	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16360395		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	20228225	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15633209, 24351813, 24495874, 31341412, 32730361, 33964921, 34085699, 39675785	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26462839, 33129621	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	34504204	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16094077, 31277459		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33819196	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24884871, 32439797	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25415223	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26910919, 30272265	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22438899	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	23318994		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22684947		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	27165639		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28150292	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	35618744	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	30289917	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24868552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35977003	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36693381	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	20943047	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	30718282		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	27778126, 29988532		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	24586509, 25624220, 30097691, 31232926	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	BEFREE	29903545, 30097691, 31232926, 31839965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	30974283		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	18569454, 30379898	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	25333814, 32785988	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30872008		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10825390, 26296699, 29275013, 29669581		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	26555697	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	17505511, 19257857		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19257857		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	23150742		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	23150742	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	31399711		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35589822	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	30785638	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	30507970	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	30507970		★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	29944680, 31440939		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	22892369	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	23012327	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	CTD_human_DG	18957084		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	29048741		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10393705		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28233092		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	12016104		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15764644, 20888880, 23333920, 27516147, 28379462, 29709671, 29804489, 30118441, 30666727, 30952808		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	25587209	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11418676, 20525556, 21229279, 26147061		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30379898		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29223680, 36459652, 36737481	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37686198	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22520466, 31790273		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10433925, 20360984, 26721935, 33879239	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37055495	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16571117		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	24438206	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	16571117, 26133168, 33985413, 34233297, 34559115, 36246978, 39399504	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30381616		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18843029, 19821051, 25671296, 27034164, 29061646, 29456737, 9129152		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22593190	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25671296, 29061646, 30973890, 34233297, 34539647, 34559115, 38151286	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35429245	Stimulate	★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement Component Deficiency	GENOMICS_ENGLAND_DG	15554930		★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement Component Deficiency	CLINVAR_DG	15831990		★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement Component Deficiency	BEFREE	17407100, 2792129		★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement Component Deficiency	UNIPROT_DG	8871666, 9218625, 9856499		★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement Component Deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	GENOMICS_ENGLAND_DG	15554930		★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	BEFREE	409732, 7523157		★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	23458521, 26376789, 27155352, 28067328, 28614914		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	11418676		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	35711443	Associate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	22192885		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30779709, 31501486		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10537342, 15126779, 19095263		★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	32016117	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	33144639	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28189264		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	14578618, 30333306, 38152968	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24146036, 28189264, 28397248		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35345521	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28189264		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	14578618	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	35345521	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	28842514	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	24153332		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	29127442		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33780352	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19421322, 33879239	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29072496		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37228614	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	LHGDN	18282714, 18702954		★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	18775023, 31485460		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18026571	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19399182, 30598261	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21649525		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	30869827		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36045687	Stimulate	★☆☆☆☆ Found in Text Mining only
Dacryocystitis	Dacryocystitis	Pubtator	35662094	Stimulate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12718750, 12932287, 15965952, 17265155, 25955863, 28108560		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	29669581		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	23078780		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29518260	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30379898		★☆☆☆☆ Found in Text Mining only
Dentinogenesis Imperfecta	Dentinogenesis Imperfecta	BEFREE	9084665		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36911710	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	10504443, 12060402	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22132893, 22272250, 25315214, 28821884, 39332980, 39599592	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33975024	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	10504443, 37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	10504443, 19818069, 28401489, 28446581		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11344355, 15149503, 25980674, 29989151, 31622668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	10233762, 27892610, 31447864		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28487565, 30101523		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	33305541, 36622131, 39808289, 39923079	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	30861625		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19187771, 24529741, 28154179, 28753646, 30025786, 30273603		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31783860	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18385799, 22385239, 28427244, 33371882	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19187771, 24529741, 28154179, 28753646, 30025786, 30273603		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21203348, 26268591	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16717396, 16931519, 19641142, 20059481, 20966598, 24965593, 32797474, 35693790	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29881878, 32797474	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28427244, 36557031	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33742062	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34572567	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	12819903		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19410617, 19447045, 19943328, 20635178, 20648615, 24529741, 24977661, 27797910, 31112279		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25048951, 26945994, 30674322, 31698809		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27165639		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	27165639	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	24619879	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30273603		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26268591	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27935598, 31758977		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	35398299	Stimulate	★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	27461653		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27943355		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	29127442		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	26708691	Stimulate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	24977661		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	19850844, 36187125, 39884388	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	39884388	Stimulate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	21203348	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28316372	Associate	★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	25821806	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11344355, 15149503, 28436448, 29989151, 31622668		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	17709485, 19782379, 23382563, 23630573, 28693588, 29374213, 31283843		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	17709485, 23639073	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	19479051	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18424889		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14506929, 26775710		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	18281042		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18281042	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39458478	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	33663574	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11160341		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22675025, 28537901		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22675025, 28537901		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22675025	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26317795	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33374641	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22697070	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24374540		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	28862188	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23066023, 25048951, 27826704, 28011152, 30964207, 31758647		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	29374213		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22136974, 25559603, 28067328, 28578937, 28614914, 29860220, 31464928, 31805036		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	10805209		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34171432	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	11091274, 36973348	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	23460743		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	35538132	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	30333306	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	30679579		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	11472436	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	23536807	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18670452, 27461653, 29399410, 9209276		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20617365, 27461653, 31142630, 36430394, 36834974, 40211130	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18670452, 27461653, 29399410, 9209276		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12946268, 21051441, 28319047, 30379898		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18538864		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30379898	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34162919	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11752021, 21454254		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	21454254	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	27122966	Stimulate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28765149		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	28057639	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12107104, 12864798, 24977661, 28450957, 31059842, 31813786		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	12107104	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	16717396, 35720300	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	17244787		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	24924312	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29768624		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	12864798, 20929277, 24977661, 28674524, 28698095, 30511181, 31485460, 31813786		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	18415893		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	33578562, 36243929, 36266640	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23363816, 35905218, 36510962	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	11909910	Associate	★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	BEFREE	30523038		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	26708691	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	12133984	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27165639	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30779709, 31501486		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37304261	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	14978762		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23291247		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	37175780	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	23353785		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	11207658	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	37108648	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	11152506	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B Chronic	Hepatitis b	Pubtator	11207658, 28614914	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	11152506, 20483710, 22471703, 22491449, 23770038, 28387899	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22535775, 23325615, 24351813, 26911712, 39766770	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	11207658	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22132893, 22491449, 23325615, 24278230, 26339796, 28376103, 28862188, 30507970, 33129621, 39766770	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24130824	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	28387899	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	30597709		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	36248794	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10194423, 12115499, 15751051		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10194423, 18070985, 20519630, 24141626	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19447045, 26861446		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19447045, 26861446	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	8496693	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	21508169	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	26831417	Associate	★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	BEFREE	22674409		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22697070	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30864351	Associate	★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	23630573		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	24977661		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	39185418	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26861446, 37731495	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34398242	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	19105984		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20404089, 27428020, 29053336		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20404089, 27107963, 29053336, 39185418	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38226605	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28955339		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	20153790, 31530029		★☆☆☆☆ Found in Text Mining only
Immunodeficiency due to a late component of complement deficiency	Immunodeficiency	Orphanet			★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28239376, 30472104, 30541853		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27776263, 29223680		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	12965263		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20848514, 28899907, 30092202, 30137309, 31567972		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21087446, 37228614	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30092202	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	11523046		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28862188	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	CTD_human_DG	18957084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29048741, 29372285		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Diseases	Intestinal disease	Pubtator	30097691	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	29671006		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	23887838	Associate	★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	29448936		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30521948		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	15743470, 16507178		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	16507178		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	28042949		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12919091, 22132893, 22892369, 29567951, 35891358	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	14596426, 22892369, 27277862, 30273603		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37540227	Stimulate	★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	19435799		★☆☆☆☆ Found in Text Mining only
Leishmaniasis Mucocutaneous	Leishmaniasis	Pubtator	29116188	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	21508169, 26831417	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	24189521, 28126361		★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	8496693	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2437586, 28471454		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37554265	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23919981	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30026572	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	17875534		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	31758977		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17444857, 20970952, 26462839, 28142122, 28592115, 28638480, 28670372, 30711627, 31296243		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11418676, 20525556, 21229279, 26147061, 28614914		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	26339796	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11207658	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23480180	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	11207658	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	29880273, 30507970, 34497613, 35485686, 37108648	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31860081	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	27284092	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	29880273	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10385645		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17550373, 20404089, 25289758, 31379071, 31783271, 34745109	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	20404089, 26066058, 29843631, 30885152, 31783271		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23743311	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	23056449, 37587067, 37995465, 39808289	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32691471	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	18259970	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	20089076, 30523277		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23762239, 36688994	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28859328, 29264699		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	36212172	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	26568320	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	33879674, 36212172	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19175619, 24292724, 24451065, 24460726, 26138472, 27814627	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19404947, 19790071, 26815287, 26930567, 27412348, 34090843, 37204055	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28118537, 28859328, 29264699		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24292724, 24977661, 26138472, 27614982, 28234905, 28619037, 28859328, 29264699, 30092845, 30185417, 31379847, 31479651, 31597273		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	18771958, 21303425, 22896023, 25554644, 29253517, 29653499, 30618193, 31597273		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	19021013	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28859328, 29264699		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	25656804		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	12930373, 34461635	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	12930373, 27559680		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21744323, 33578562	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22914896, 30379898		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30379898	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31616630, 9699721		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10393857	Associate	★☆☆☆☆ Found in Text Mining only
Lysinuric Protein Intolerance	Lysinuric Protein Intolerance	BEFREE	26210182		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	27296321, 28807602		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29348424, 35370941	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30894217	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18504423, 30826620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18504423		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21357438		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15081542, 17018607, 23213058, 26079660, 27002757, 28209986, 29689563, 30177620, 31054033, 31544897		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22675025, 28537901		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22684947		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25415223, 26423423, 28465448		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12445196		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22022583, 30258285		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31839674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16094077, 31277459		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11948506, 17444857, 21254158, 23213058, 26462839, 27549123, 28209986, 28234357, 29449068, 29588321, 29902349, 30188739, 30252138, 31221150		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19257857		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15081542, 17018607, 27707838		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17018607		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus syndrome congenital	Melanocytic nevus	Pubtator	21508508	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10629557, 12485448, 15194051, 1910690, 21953496, 23370279, 24127910, 26102027, 27549123, 29331419, 31216116, 31578309		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21338484, 21953496, 24463459, 25765738, 26277786, 27549123, 27764787, 31216116, 32002296, 34593622	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38239354	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36443341	Associate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	22896023		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	20118240		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	20118240	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29331419		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	31212905		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	39672520	Inhibit	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20041963	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20059481	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25029526, 36510962, 37641028	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15608388, 25605650	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35699824, 36449533	Associate	★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	12864798		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	28106886		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24699306, 26115406, 28702457		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26115406	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10079101, 10359806, 11909910, 17220550, 19225413, 21255008, 37627269, 38346270	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10840276, 12162873, 17250724, 19969087, 23085936, 28237728, 28578025, 28870573, 29893515, 30270021, 30426906		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23637915, 29518260	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31421626		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	15843529, 26845678		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	15843529		★☆☆☆☆ Found in Text Mining only
Myasthenias	Myasthenia Gravis	BEFREE	15843529		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	34130612	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28979704		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	30695099		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24868552, 26861446		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27152707		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	23150742		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	23150742	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	40114239	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	24594700	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33530452, 34580642, 39529136	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15751051, 18087217		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18087217, 28207826	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27765529, 32986378, 34544905, 36107539	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	32986357	Associate	★☆☆☆☆ Found in Text Mining only
Neonatal hyperglycemia	Hyperglycemia	BEFREE	29544513		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10537342, 10706701, 11265771, 11358987, 12485448, 12946268, 15063730, 15126779, 15194051, 15925544, 19257857, 19821051, 20418899, 21051441, 21945666, 21953496, 22333315, 22684947, 22753274, 23213058, 23759675, 24699306, 24725474, 25175315, 25212604, 25415223, 25515795, 25724086, 26025380, 26087182, 26503055, 27002757, 27034164, 27529817, 27549123, 27943355, 28042949, 28076333, 28318643, 28319047, 28537901, 28592115, 28638480, 28662055, 28670372, 28674001, 28840842, 29248547, 29301792, 29331419, 29416784, 29449068, 29456737, 29588321, 29671006, 29689563, 29853604, 30202097, 30381616, 30483809, 30500835, 30713791, 31105699, 31221150, 31296243, 31393905, 31417907, 31451071, 31848186, 9108380, 9516150		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	22896023		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	23637915	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	15518810		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28882441		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	34016720	Associate	★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	30728335		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	30728335		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30076959		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	25378811		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	10194423		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27826704, 28824718, 30964207		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23658645, 29916282, 31447002		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25048951, 28824718, 31758647		★☆☆☆☆ Found in Text Mining only
Nongranulomatous uveitis	Nongranulomatous uveitis	BEFREE	29715366		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19289381, 25048951, 29795466		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23760409, 39702497	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23894433, 30177354, 34419146, 38175171	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	17550373	Stimulate	★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	15317705	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14579283, 27519904, 32384383	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35734177	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28829242, 31590365		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31426811		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	34710525	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23329517, 36755691, 36973348, 40496565	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27529817		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	8774358		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22684947		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24762504, 25712684, 27490802, 34220848, 36798787, 38143770, 39702497, 40215819	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34794429	Stimulate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	CTD_human_DG	18957084		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25415223, 26423423, 28465448		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30685120		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25415223, 26423423, 29157747, 36782176, 37338014	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	20041963	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	29659906	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	17912012		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	26423423		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19755523, 29416784		★☆☆☆☆ Found in Text Mining only
Papillon-Lefevre Disease	Papillon-Lefevre Disease	BEFREE	21380503		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	23284797, 30400920, 34764955, 36052089	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34536521, 36352407	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	29944680, 31440939		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	33331471	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	18435806, 19616927, 21255696		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	18435806	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	11472436, 25483140	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	38152968	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	11912115		★☆☆☆☆ Found in Text Mining only
Peripheral motor neuropathy	Motor nerve neuritis	BEFREE	30523038		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	24080983	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	31086200	Stimulate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27935598		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	31356620		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	30711154		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30249452		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28051885		★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	18606876		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	26873848		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30532071		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	22058116		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	23078780		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	11207658, 16243485, 23480180		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	18573422	Stimulate	★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	36167867	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	26306400	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16934957		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16934957, 36524848, 38087324	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	16150856, 21443535, 25263691, 26339796, 28862188, 29853737, 29948377, 31485460		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11310827, 11344355, 23376980, 27389865, 28436448		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	12485430, 15955098	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	1724247, 21255008, 38115636	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	30511160		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	35618730	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17996064, 18684970	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20395558, 23384071, 32757672, 34335580	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23514217	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10537342, 15126779, 19095263		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28046003, 31542508		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	20627090, 34987646	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	33371882, 34544594	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	26037167	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11207658, 12718750, 12932287, 17265155, 19105984, 20604932, 21708014, 23092582, 24574215, 25702175, 25982097, 26367725, 26711533, 28592626, 28724396, 29378189, 29998825, 31045763, 31275320, 31652652		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12718750		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	17052298, 31783271		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17550373, 24199653	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21255008, 31783271	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	17550373	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29156834		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	39345889	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	28974776	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37372943	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37471168	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21303517, 36077548, 37372943, 37587067	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	35674522	Stimulate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	22048272		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34461635	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31013257, 31628962		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15657466, 15860669, 17052299, 17540042, 24077366		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	22627769		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	22627769	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	27902344, 29391069		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12384933, 26815287, 31086200	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	17075845, 31733111	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12485430	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	17274000	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	21708014		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28385330		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	38175171	Associate	★☆☆☆☆ Found in Text Mining only
Somatotrophinoma, Familial	Somatotroph adenoma	BEFREE	28921877		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	17265155		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	16846531	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12445196, 12485448, 15751051, 19435799		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26317795		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21085979, 24395654, 28176846, 34247149, 36510962	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28919775		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	11257077		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24374540, 25048951, 28824718, 30964207		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22022583, 30258285		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29690901, 32685487, 34413454, 35111412	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27576738		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	31530029		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	17265155		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	27296321		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19105984, 28859262, 29127442, 29944680, 30804934, 31440939		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31101882		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	30679579		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	24894780	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	24924312, 31059842, 31813786		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33345267	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36266640, 36438899	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31839674		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	11600578		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	26361424	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31839674		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31839674	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroiditis	Thyroiditis	LHGDN	18282714		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	28698095		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27245471, 34868029	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	22530001	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	19342252		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30111819		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31921107, 31924747, 34158843, 35377948	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18085351		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19203362, 23117395		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	18504423		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34517533	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	36539847	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	17505511		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17505511	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	30093564, 30702560		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30093564	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29944680		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	35061677	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	19729323	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	23630573		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	18775023, 31485460		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	23150742	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28376103		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	28376103	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	26322948	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	28385330, 29115683		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	32532953, 33463119, 35464413, 35653192	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	28385330, 29115683		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	32542038, 33371882, 34544594	Stimulate	★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	22192885		★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	BEFREE	9690917		★☆☆☆☆ Found in Text Mining only