INCENP (inner centromere protein)

Gene

• Entrez ID: 3619
• Gene name: Inner centromere protein
• Gene symbol: INCENP
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: In mammalian cells, 2 broad groups of centromere-interacting proteins have been described: constitutively binding centromere proteins and `passenger,` or transiently interacting, proteins (reviewed by Choo, 1997). The constitutive proteins include CENPA (

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs61893682	G>C	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021587	hsa-miR-142-3p	Microarray	17612493
MIRT025087	hsa-miR-181a-5p	Microarray	17612493
MIRT042486	hsa-miR-423-3p	CLASH	23622248
MIRT716934	hsa-miR-216a-5p	HITS-CLIP	19536157
MIRT709386	hsa-miR-24-1-5p	HITS-CLIP	19536157
MIRT709385	hsa-miR-24-2-5p	HITS-CLIP	19536157
MIRT709384	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT709383	hsa-miR-3622b-5p	HITS-CLIP	19536157
MIRT709382	hsa-miR-4467	HITS-CLIP	19536157
MIRT709381	hsa-miR-6770-3p	HITS-CLIP	19536157
MIRT709386	hsa-miR-24-1-5p	HITS-CLIP	19536157
MIRT709385	hsa-miR-24-2-5p	HITS-CLIP	19536157
MIRT709384	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT709383	hsa-miR-3622b-5p	HITS-CLIP	19536157
MIRT709382	hsa-miR-4467	HITS-CLIP	19536157
MIRT709381	hsa-miR-6770-3p	HITS-CLIP	19536157
MIRT550368	hsa-miR-4282	HITS-CLIP	23824327
MIRT550362	hsa-miR-4428	PAR-CLIP	20371350
MIRT550361	hsa-miR-5683	PAR-CLIP	20371350
MIRT550360	hsa-miR-4491	PAR-CLIP	20371350
MIRT550359	hsa-miR-4657	PAR-CLIP	20371350
MIRT131161	hsa-miR-299-3p	PAR-CLIP	20371350
MIRT550358	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT550357	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT550356	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT550355	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT550354	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT550353	hsa-miR-4306	PAR-CLIP	20371350
MIRT550352	hsa-miR-4644	PAR-CLIP	20371350
MIRT550351	hsa-miR-4470	PAR-CLIP	20371350
MIRT550350	hsa-miR-5681b	PAR-CLIP	20371350
MIRT550349	hsa-miR-4536-5p	PAR-CLIP	20371350
MIRT550348	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT550347	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT550346	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT550368	hsa-miR-4282	PAR-CLIP	20371350
MIRT131172	hsa-miR-548u	PAR-CLIP	20371350
MIRT131193	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT550368	hsa-miR-4282	PAR-CLIP	21572407
MIRT515486	hsa-miR-3123	PAR-CLIP	21572407
MIRT550367	hsa-miR-5584-5p	PAR-CLIP	21572407
MIRT550366	hsa-miR-6750-5p	PAR-CLIP	21572407
MIRT550365	hsa-miR-6822-5p	PAR-CLIP	21572407
MIRT515487	hsa-miR-9500	PAR-CLIP	21572407
MIRT515485	hsa-miR-135a-3p	PAR-CLIP	21572407
MIRT515484	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT515483	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT515482	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT515481	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT515480	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT515479	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT550364	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT550363	hsa-miR-3919	PAR-CLIP	21572407
MIRT515478	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT515477	hsa-miR-554	PAR-CLIP	21572407
MIRT515476	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT515475	hsa-miR-219a-2-3p	PAR-CLIP	21572407
MIRT515474	hsa-miR-3148	PAR-CLIP	21572407
MIRT515473	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT515472	hsa-miR-183-3p	PAR-CLIP	21572407
MIRT515471	hsa-miR-4452	PAR-CLIP	21572407
MIRT550362	hsa-miR-4428	PAR-CLIP	21572407
MIRT550361	hsa-miR-5683	PAR-CLIP	21572407
MIRT550360	hsa-miR-4491	PAR-CLIP	21572407
MIRT550359	hsa-miR-4657	PAR-CLIP	21572407
MIRT131161	hsa-miR-299-3p	PAR-CLIP	21572407
MIRT550358	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT550357	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT550356	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT550355	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT550354	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT550353	hsa-miR-4306	PAR-CLIP	21572407
MIRT550352	hsa-miR-4644	PAR-CLIP	21572407
MIRT550351	hsa-miR-4470	PAR-CLIP	21572407
MIRT550350	hsa-miR-5681b	PAR-CLIP	21572407
MIRT550349	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT550348	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT550347	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT550346	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT515486	hsa-miR-3123	PAR-CLIP	23446348
MIRT515487	hsa-miR-9500	PAR-CLIP	23446348
MIRT515485	hsa-miR-135a-3p	PAR-CLIP	23446348
MIRT515484	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT515483	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT515482	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT515481	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT515480	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT515479	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT515478	hsa-miR-4756-3p	PAR-CLIP	23446348
MIRT515477	hsa-miR-554	PAR-CLIP	23446348
MIRT515476	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT515475	hsa-miR-219a-2-3p	PAR-CLIP	23446348
MIRT515474	hsa-miR-3148	PAR-CLIP	23446348
MIRT515473	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT515472	hsa-miR-183-3p	PAR-CLIP	23446348
MIRT515471	hsa-miR-4452	PAR-CLIP	23446348
MIRT131172	hsa-miR-548u	PAR-CLIP	23446348
MIRT131193	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT495003	hsa-miR-520d-5p	PAR-CLIP	23708386
MIRT495002	hsa-miR-524-5p	PAR-CLIP	23708386
MIRT025087	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT131157	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT131158	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT131162	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT716934	hsa-miR-216a-5p	HITS-CLIP	19536157
MIRT709386	hsa-miR-24-1-5p	HITS-CLIP	19536157
MIRT709385	hsa-miR-24-2-5p	HITS-CLIP	19536157
MIRT709384	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT709383	hsa-miR-3622b-5p	HITS-CLIP	19536157
MIRT709382	hsa-miR-4467	HITS-CLIP	19536157
MIRT709381	hsa-miR-6770-3p	HITS-CLIP	19536157
MIRT709386	hsa-miR-24-1-5p	HITS-CLIP	19536157
MIRT709385	hsa-miR-24-2-5p	HITS-CLIP	19536157
MIRT709384	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT709383	hsa-miR-3622b-5p	HITS-CLIP	19536157
MIRT709382	hsa-miR-4467	HITS-CLIP	19536157
MIRT709381	hsa-miR-6770-3p	HITS-CLIP	19536157
MIRT550368	hsa-miR-4282	HITS-CLIP	23824327
MIRT550362	hsa-miR-4428	PAR-CLIP	20371350
MIRT550361	hsa-miR-5683	PAR-CLIP	20371350
MIRT550360	hsa-miR-4491	PAR-CLIP	20371350
MIRT550359	hsa-miR-4657	PAR-CLIP	20371350
MIRT131161	hsa-miR-299-3p	PAR-CLIP	20371350
MIRT550358	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT550357	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT550356	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT550355	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT550354	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT550353	hsa-miR-4306	PAR-CLIP	20371350
MIRT550352	hsa-miR-4644	PAR-CLIP	20371350
MIRT550351	hsa-miR-4470	PAR-CLIP	20371350
MIRT550350	hsa-miR-5681b	PAR-CLIP	20371350
MIRT550349	hsa-miR-4536-5p	PAR-CLIP	20371350
MIRT550348	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT550347	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT550346	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT550368	hsa-miR-4282	PAR-CLIP	20371350
MIRT131172	hsa-miR-548u	PAR-CLIP	20371350
MIRT131193	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT550368	hsa-miR-4282	PAR-CLIP	21572407
MIRT515486	hsa-miR-3123	PAR-CLIP	21572407
MIRT550367	hsa-miR-5584-5p	PAR-CLIP	21572407
MIRT550366	hsa-miR-6750-5p	PAR-CLIP	21572407
MIRT550365	hsa-miR-6822-5p	PAR-CLIP	21572407
MIRT515487	hsa-miR-9500	PAR-CLIP	21572407
MIRT515485	hsa-miR-135a-3p	PAR-CLIP	21572407
MIRT515484	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT515483	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT515482	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT515481	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT515480	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT515479	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT550364	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT550363	hsa-miR-3919	PAR-CLIP	21572407
MIRT515478	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT515477	hsa-miR-554	PAR-CLIP	21572407
MIRT515476	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT515475	hsa-miR-219a-2-3p	PAR-CLIP	21572407
MIRT515474	hsa-miR-3148	PAR-CLIP	21572407
MIRT515473	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT515472	hsa-miR-183-3p	PAR-CLIP	21572407
MIRT515471	hsa-miR-4452	PAR-CLIP	21572407
MIRT550362	hsa-miR-4428	PAR-CLIP	21572407
MIRT550361	hsa-miR-5683	PAR-CLIP	21572407
MIRT550360	hsa-miR-4491	PAR-CLIP	21572407
MIRT550359	hsa-miR-4657	PAR-CLIP	21572407
MIRT131161	hsa-miR-299-3p	PAR-CLIP	21572407
MIRT550358	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT550357	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT550356	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT550355	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT550354	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT550353	hsa-miR-4306	PAR-CLIP	21572407
MIRT550352	hsa-miR-4644	PAR-CLIP	21572407
MIRT550351	hsa-miR-4470	PAR-CLIP	21572407
MIRT550350	hsa-miR-5681b	PAR-CLIP	21572407
MIRT550349	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT550348	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT550347	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT550346	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT515486	hsa-miR-3123	PAR-CLIP	23446348
MIRT515487	hsa-miR-9500	PAR-CLIP	23446348
MIRT515485	hsa-miR-135a-3p	PAR-CLIP	23446348
MIRT515484	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT515483	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT515482	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT515481	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT515480	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT515479	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT515478	hsa-miR-4756-3p	PAR-CLIP	23446348
MIRT515477	hsa-miR-554	PAR-CLIP	23446348
MIRT515476	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT515475	hsa-miR-219a-2-3p	PAR-CLIP	23446348
MIRT515474	hsa-miR-3148	PAR-CLIP	23446348
MIRT515473	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT515472	hsa-miR-183-3p	PAR-CLIP	23446348
MIRT515471	hsa-miR-4452	PAR-CLIP	23446348
MIRT131172	hsa-miR-548u	PAR-CLIP	23446348
MIRT131193	hsa-miR-7161-5p	PAR-CLIP	23446348
MIRT495003	hsa-miR-520d-5p	PAR-CLIP	23708386
MIRT495002	hsa-miR-524-5p	PAR-CLIP	23708386
MIRT1066196	hsa-miR-3136-3p	CLIP-seq
MIRT1066197	hsa-miR-3184	CLIP-seq
MIRT1066198	hsa-miR-423-5p	CLIP-seq
MIRT1066199	hsa-miR-4802-5p	CLIP-seq
MIRT1066200	hsa-miR-510	CLIP-seq
MIRT1066201	hsa-miR-512-5p	CLIP-seq
MIRT1066202	hsa-miR-548v	CLIP-seq
MIRT1066203	hsa-miR-663b	CLIP-seq
MIRT1066204	hsa-miR-1252	CLIP-seq
MIRT1066205	hsa-miR-1324	CLIP-seq
MIRT1066206	hsa-miR-214	CLIP-seq
MIRT1066196	hsa-miR-3136-3p	CLIP-seq
MIRT1066207	hsa-miR-3619-5p	CLIP-seq
MIRT1066208	hsa-miR-421	CLIP-seq
MIRT1066209	hsa-miR-4635	CLIP-seq
MIRT1066210	hsa-miR-4690-5p	CLIP-seq
MIRT1066211	hsa-miR-4709-5p	CLIP-seq
MIRT1066212	hsa-miR-4802-3p	CLIP-seq
MIRT1066202	hsa-miR-548v	CLIP-seq
MIRT1066213	hsa-miR-761	CLIP-seq
MIRT1550149	hsa-miR-30a	CLIP-seq
MIRT1550150	hsa-miR-30b	CLIP-seq
MIRT1550151	hsa-miR-30c	CLIP-seq
MIRT1550152	hsa-miR-30d	CLIP-seq
MIRT1550153	hsa-miR-30e	CLIP-seq
MIRT2015812	hsa-miR-1226	CLIP-seq
MIRT2015813	hsa-miR-197	CLIP-seq
MIRT2015814	hsa-miR-2682	CLIP-seq
MIRT2015815	hsa-miR-3143	CLIP-seq
MIRT2015816	hsa-miR-3197	CLIP-seq
MIRT2015817	hsa-miR-3662	CLIP-seq
MIRT2015818	hsa-miR-376c	CLIP-seq
MIRT2015819	hsa-miR-3977	CLIP-seq
MIRT2015820	hsa-miR-412	CLIP-seq
MIRT2015821	hsa-miR-449c	CLIP-seq
MIRT2015822	hsa-miR-4514	CLIP-seq
MIRT2015823	hsa-miR-4660	CLIP-seq
MIRT2015824	hsa-miR-4692	CLIP-seq
MIRT2015825	hsa-miR-4733-3p	CLIP-seq
MIRT2015826	hsa-miR-513a-5p	CLIP-seq
MIRT2015827	hsa-miR-543	CLIP-seq
MIRT2015828	hsa-miR-634	CLIP-seq
MIRT2015829	hsa-miR-940	CLIP-seq
MIRT2248274	hsa-miR-103a	CLIP-seq
MIRT2248275	hsa-miR-107	CLIP-seq
MIRT2248276	hsa-miR-1184	CLIP-seq
MIRT2248277	hsa-miR-1205	CLIP-seq
MIRT1066204	hsa-miR-1252	CLIP-seq
MIRT2248278	hsa-miR-1286	CLIP-seq
MIRT2248279	hsa-miR-140-3p	CLIP-seq
MIRT2248280	hsa-miR-150	CLIP-seq
MIRT2248281	hsa-miR-181a	CLIP-seq
MIRT2248282	hsa-miR-181b	CLIP-seq
MIRT2248283	hsa-miR-181c	CLIP-seq
MIRT2248284	hsa-miR-181d	CLIP-seq
MIRT2248285	hsa-miR-1972	CLIP-seq
MIRT2248286	hsa-miR-2110	CLIP-seq
MIRT1066206	hsa-miR-214	CLIP-seq
MIRT2248287	hsa-miR-3120-5p	CLIP-seq
MIRT1066196	hsa-miR-3136-3p	CLIP-seq
MIRT2015815	hsa-miR-3143	CLIP-seq
MIRT2248288	hsa-miR-3151	CLIP-seq
MIRT2248289	hsa-miR-3158-5p	CLIP-seq
MIRT1066197	hsa-miR-3184	CLIP-seq
MIRT2015816	hsa-miR-3197	CLIP-seq
MIRT2248290	hsa-miR-3199	CLIP-seq
MIRT2248291	hsa-miR-346	CLIP-seq
MIRT1066207	hsa-miR-3619-5p	CLIP-seq
MIRT2015817	hsa-miR-3662	CLIP-seq
MIRT2248292	hsa-miR-3926	CLIP-seq
MIRT1066208	hsa-miR-421	CLIP-seq
MIRT1066198	hsa-miR-423-5p	CLIP-seq
MIRT2248293	hsa-miR-4252	CLIP-seq
MIRT2248294	hsa-miR-4262	CLIP-seq
MIRT2248295	hsa-miR-4271	CLIP-seq
MIRT2248296	hsa-miR-4283	CLIP-seq
MIRT2248297	hsa-miR-4288	CLIP-seq
MIRT2248298	hsa-miR-4290	CLIP-seq
MIRT2248299	hsa-miR-4446-3p	CLIP-seq
MIRT2248300	hsa-miR-4447	CLIP-seq
MIRT2248301	hsa-miR-4456	CLIP-seq
MIRT2248302	hsa-miR-4472	CLIP-seq
MIRT2248303	hsa-miR-4489	CLIP-seq
MIRT2248304	hsa-miR-4492	CLIP-seq
MIRT2248305	hsa-miR-4498	CLIP-seq
MIRT2248306	hsa-miR-4505	CLIP-seq
MIRT2015822	hsa-miR-4514	CLIP-seq
MIRT1066209	hsa-miR-4635	CLIP-seq
MIRT2248307	hsa-miR-4649-3p	CLIP-seq
MIRT2248308	hsa-miR-4667-5p	CLIP-seq
MIRT2248309	hsa-miR-4687-5p	CLIP-seq
MIRT1066210	hsa-miR-4690-5p	CLIP-seq
MIRT2015824	hsa-miR-4692	CLIP-seq
MIRT2248310	hsa-miR-4699-3p	CLIP-seq
MIRT2248311	hsa-miR-4700-5p	CLIP-seq
MIRT1066211	hsa-miR-4709-5p	CLIP-seq
MIRT2248312	hsa-miR-4715-3p	CLIP-seq
MIRT2248313	hsa-miR-4717-5p	CLIP-seq
MIRT2248314	hsa-miR-4722-3p	CLIP-seq
MIRT2248315	hsa-miR-4725-3p	CLIP-seq
MIRT2248316	hsa-miR-4740-5p	CLIP-seq
MIRT2248317	hsa-miR-4797-5p	CLIP-seq
MIRT1066199	hsa-miR-4802-5p	CLIP-seq
MIRT2248318	hsa-miR-491-5p	CLIP-seq
MIRT2015827	hsa-miR-543	CLIP-seq
MIRT2248319	hsa-miR-548s	CLIP-seq
MIRT1066202	hsa-miR-548v	CLIP-seq
MIRT2248320	hsa-miR-632	CLIP-seq
MIRT2248321	hsa-miR-661	CLIP-seq
MIRT1066203	hsa-miR-663b	CLIP-seq
MIRT1066213	hsa-miR-761	CLIP-seq
MIRT2248322	hsa-miR-762	CLIP-seq
MIRT2015829	hsa-miR-940	CLIP-seq
MIRT2389426	hsa-miR-101	CLIP-seq
MIRT2248276	hsa-miR-1184	CLIP-seq
MIRT2248277	hsa-miR-1205	CLIP-seq
MIRT2389427	hsa-miR-139-5p	CLIP-seq
MIRT2389428	hsa-miR-144	CLIP-seq
MIRT2248285	hsa-miR-1972	CLIP-seq
MIRT2248287	hsa-miR-3120-5p	CLIP-seq
MIRT2248289	hsa-miR-3158-5p	CLIP-seq
MIRT1066197	hsa-miR-3184	CLIP-seq
MIRT2248291	hsa-miR-346	CLIP-seq
MIRT1066198	hsa-miR-423-5p	CLIP-seq
MIRT2248297	hsa-miR-4288	CLIP-seq
MIRT2248303	hsa-miR-4489	CLIP-seq
MIRT2389429	hsa-miR-4508	CLIP-seq
MIRT2389430	hsa-miR-4532	CLIP-seq
MIRT2248310	hsa-miR-4699-3p	CLIP-seq
MIRT2248317	hsa-miR-4797-5p	CLIP-seq
MIRT1066199	hsa-miR-4802-5p	CLIP-seq
MIRT2389431	hsa-miR-514	CLIP-seq
MIRT2389432	hsa-miR-514b-3p	CLIP-seq
MIRT1066202	hsa-miR-548v	CLIP-seq
MIRT2389433	hsa-miR-549	CLIP-seq
MIRT2389434	hsa-miR-586	CLIP-seq
MIRT2248320	hsa-miR-632	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	NAS	17956729
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0000281	Process	Mitotic cytokinesis	IMP	16239925
GO:0000281	Process	Mitotic cytokinesis	NAS	17956729
GO:0000775	Component	Chromosome, centromeric region	IDA	11084331, 16239925
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	16760428
GO:0000776	Component	Kinetochore	IEA
GO:0000795	Component	Synaptonemal complex	IEA
GO:0000800	Component	Lateral element	IEA
GO:0000801	Component	Central element	IEA
GO:0005515	Function	Protein binding	IPI	9864353, 14610074, 16239925, 17099693, 17956729, 19357306, 20562864, 20739936, 21051298, 21225229, 21346195, 27332895, 29568061, 30021884, 32707033, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005721	Component	Pericentric heterochromatin	IDA	9864353
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	9864353
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	IMP	16239925
GO:0010369	Component	Chromocenter	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA	9859993
GO:0016604	Component	Nuclear body	IDA
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA
GO:0030496	Component	Midbody	IEA
GO:0032133	Component	Chromosome passenger complex	IBA
GO:0032133	Component	Chromosome passenger complex	IPI	17956729
GO:0032991	Component	Protein-containing complex	IDA	16239925
GO:0051256	Process	Mitotic spindle midzone assembly	NAS	17956729
GO:0051257	Process	Meiotic spindle midzone assembly	IBA
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase chromosome alignment	IBA
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	NAS	17956729
GO:0090307	Process	Mitotic spindle assembly	NAS	17956729
GO:0140677	Function	Molecular function activator activity	IPI	27332895
GO:1901970	Process	Positive regulation of mitotic sister chromatid separation	NAS	17956729
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	NAS	17956729
GO:1903490	Process	Positive regulation of mitotic cytokinesis	NAS	17956729
GO:1990385	Component	Meiotic spindle midzone	IBA

Other IDs

• MIM: 604411
• HGNC: 6058
• e!Ensembl: ENSG00000149503

Protein

• UniProt ID: Q9NQS7
• Protein name: Inner centromere protein
• Protein function: Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chrom
• PDB: 2QFA, 4AF3, 5IEH, 5IEK, 6GR8, 6GR9, 6YIE, 6YIF, 6YIH, 8RUP, 9ESA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12178	INCENP_N	6 → 41	Chromosome passenger complex (CPC) protein INCENP N terminal	Domain
  PF03941	INCENP_ARK-bind	825 → 881	Inner centromere protein, ARK binding region	Family

• Sequence:

  MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTP
  SQKNRRKKRRISYVQDENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSV
  LRRVTRAAAAAAAATMALAAPSSPTPESPTMLTKKPEDNHTQCQLVPVVEIGISERQNAE
  QHVTQLMSTEPLPRTLSPTPASATAPTSQGIPTSDEESTPKKSKARILESITVSSLMATP
  QDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRERVLAPILPDNFSTPTGSRTDS
  QSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAASGRIICHSYLE
  RLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAAS
  SPETPSAGQQEAKTDQADGPREPPQSARRKRSYKQAVSELDEEQHLEDEELQPPRSKTPS
  SPCPASKVVRPLRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTPLRMDPKCSFVEKERQ
  RLENLRRKEEAEQLRRQKVEEDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIE
  QKFAQIDEKTEKAKEERLAEEKAKKKAAAKKMEEVEARRKQEEEARRLRWLQQEEEERRH
  QELLQKKKEEEQERLRKAAEAKRLAEQREQERREQERREQERREQERREQERREQERQLA
  EQERRREQERLQAERELQEREKALRLQKEQLQRELEEKKKKEEQQRLAERQLQEEQEKKA
  KEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRK
  PIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSP
  PLQGARVPSSLAYSLKKH

• Sequence length: 918

Pathways

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
SUMOylation of DNA replication proteins
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Nephronophthisis	Likely pathogenic	rs61893682	RCV000662273	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar CTD	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aneuploidy	Aneuploidy	Pubtator	18752045	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31065785		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25586992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25586992	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33540684, 33830865	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27432226		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	26489029	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11453556		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25586992		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27432226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27432226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16427043		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27432226		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25586992		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephronophthisis	Nephronophthisis	CLINVAR_DG	26489029		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neuroblastoma	Neuroblastoma	BEFREE	30770954, 31416840		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27432226		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27432226	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36401386	Associate	★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27432226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36901944	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16427043		★☆☆☆☆ Found in Text Mining only