Gene Gene information from NCBI Gene database.
Entrez ID 3615
Gene name Inosine monophosphate dehydrogenase 2
Gene symbol IMPDH2
Synonyms (NCBI Gene)
IMPD2IMPDH-II
Chromosome 3
Chromosome location 3p21.31
Summary This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependen
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs121434586 G>A Affects Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
18
miRTarBase ID miRNA Experiments Reference
MIRT006255 hsa-miR-34a-5p Luciferase reporter assay 22301190
MIRT006255 hsa-miR-34a-5p Luciferase reporter assay 22301190
MIRT006255 hsa-miR-34a-5p Luciferase reporter assay 22301190
MIRT006255 hsa-miR-34a-5p Luciferase reporter assay 22301190
MIRT006255 hsa-miR-34a-5p Luciferase reporter assay 22301190
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
ATF2 Unknown 9278455
EGR1 Unknown 7896827
SP1 Unknown 7896827
TFAP2A Unknown 7896827
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IDA 14766016
GO:0000166 Function Nucleotide binding IEA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding IEA
GO:0003824 Function Catalytic activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
146691 6053 ENSG00000178035
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P12268
Protein name Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (Inosine-5'-monophosphate dehydrogenase type II) (IMP dehydrogenase II) (IMPDH-II)
Protein function Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell
PDB 1B3O , 1NF7 , 1NFB , 6I0M , 6I0O , 6U8E , 6U8N , 6U8R , 6U8S , 6U9O , 6UA2 , 6UA4 , 6UA5 , 6UAJ , 6UC2 , 6UDO , 6UDP , 6UDQ , 8FOZ , 8FUZ , 8G8F , 8G9B , 9DMU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00478 IMPDH 29 504 IMP dehydrogenase / GMP reductase domain Domain
PF00571 CBS 107 166 CBS domain Domain
PF00571 CBS 175 232 CBS domain Domain
Tissue specificity TISSUE SPECIFICITY: IMPDH1 is the main species in normal leukocytes and IMPDH2 predominates over IMPDH1 in the tumor.
Sequence
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRK
VKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFL
KEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRD
YPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVH
SLHSYEKRLF
Sequence length 514
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Nucleotide metabolism
  Neutrophil degranulation
Purine ribonucleoside monophosphate biosynthesis
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Dystonic disorder Likely pathogenic rs1330462697, rs2471632340 RCV001788490
RCV002468720
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOSOMAL DOMINANT DOPA-RESPONSIVE DYSTONIA Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DOPA-RESPONSIVE DYSTONIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
IMPDH2 enzyme activity, variation in Affects ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
IMPDH2-related disorder Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma CTD_human_DG 27602772
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 31371825
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain neoplasms Pubtator 31371825 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 29962242
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 31371825, 37409959 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 37063434 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 30518405
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 15670151, 38310229 Associate
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease Pubtator 30015926 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Diabetes BEFREE 23666569
★☆☆☆☆
Found in Text Mining only