Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3613
Gene name	Inositol monophosphatase 2
Gene symbol	IMPA2
Synonyms (NCBI Gene)	-
Chromosome	18
Chromosome location	18p11.21
Summary	This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disord

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042179	hsa-miR-484	CLASH	23622248
MIRT649264	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT649263	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT649261	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT649262	hsa-miR-4421	HITS-CLIP	23824327
MIRT649260	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT649257	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT649256	hsa-miR-3672	HITS-CLIP	23824327
MIRT649255	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT664663	hsa-miR-8055	HITS-CLIP	23824327
MIRT649253	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT649264	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT649263	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT649261	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT649262	hsa-miR-4421	HITS-CLIP	23824327
MIRT649260	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT649259	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT649258	hsa-miR-1976	HITS-CLIP	23824327
MIRT649257	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT649256	hsa-miR-3672	HITS-CLIP	23824327
MIRT649255	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT649253	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT649264	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT649263	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT649261	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT649262	hsa-miR-4421	HITS-CLIP	23824327
MIRT649260	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT649257	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT649256	hsa-miR-3672	HITS-CLIP	23824327
MIRT649255	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT664663	hsa-miR-8055	HITS-CLIP	23824327
MIRT649253	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT649264	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT649263	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT649261	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT649262	hsa-miR-4421	HITS-CLIP	23824327
MIRT649260	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT649259	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT649258	hsa-miR-1976	HITS-CLIP	23824327
MIRT649257	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT649256	hsa-miR-3672	HITS-CLIP	23824327
MIRT649255	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT649253	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT1065793	hsa-miR-137	CLIP-seq
MIRT1065794	hsa-miR-146a	CLIP-seq
MIRT1065795	hsa-miR-146b-5p	CLIP-seq
MIRT1065796	hsa-miR-25	CLIP-seq
MIRT1065797	hsa-miR-27a	CLIP-seq
MIRT1065798	hsa-miR-27b	CLIP-seq
MIRT1065799	hsa-miR-2861	CLIP-seq
MIRT1065800	hsa-miR-32	CLIP-seq
MIRT1065801	hsa-miR-328	CLIP-seq
MIRT1065802	hsa-miR-33a	CLIP-seq
MIRT1065803	hsa-miR-33b	CLIP-seq
MIRT1065804	hsa-miR-3591-3p	CLIP-seq
MIRT1065805	hsa-miR-363	CLIP-seq
MIRT1065806	hsa-miR-367	CLIP-seq
MIRT1065807	hsa-miR-3918	CLIP-seq
MIRT1065808	hsa-miR-4251	CLIP-seq
MIRT1065809	hsa-miR-4324	CLIP-seq
MIRT1065810	hsa-miR-4512	CLIP-seq
MIRT1065811	hsa-miR-4723-5p	CLIP-seq
MIRT1065812	hsa-miR-4728-5p	CLIP-seq
MIRT1065813	hsa-miR-4768-3p	CLIP-seq
MIRT1065814	hsa-miR-513a-5p	CLIP-seq
MIRT1065815	hsa-miR-589	CLIP-seq
MIRT1065816	hsa-miR-92a	CLIP-seq
MIRT1065817	hsa-miR-92b	CLIP-seq
MIRT2015634	hsa-miR-3622b-5p	CLIP-seq
MIRT2015635	hsa-miR-4252	CLIP-seq
MIRT2015636	hsa-miR-4468	CLIP-seq
MIRT2015637	hsa-miR-4720-5p	CLIP-seq
MIRT2015638	hsa-miR-4799-3p	CLIP-seq
MIRT2247999	hsa-miR-214	CLIP-seq
MIRT1065797	hsa-miR-27a	CLIP-seq
MIRT1065798	hsa-miR-27b	CLIP-seq
MIRT2248000	hsa-miR-3168	CLIP-seq
MIRT1065804	hsa-miR-3591-3p	CLIP-seq
MIRT2248001	hsa-miR-361-5p	CLIP-seq
MIRT2248002	hsa-miR-3619-5p	CLIP-seq
MIRT2248003	hsa-miR-4277	CLIP-seq
MIRT2248004	hsa-miR-4291	CLIP-seq
MIRT2248005	hsa-miR-4299	CLIP-seq
MIRT2248006	hsa-miR-4314	CLIP-seq
MIRT1065809	hsa-miR-4324	CLIP-seq
MIRT2248007	hsa-miR-4509	CLIP-seq
MIRT2248008	hsa-miR-4667-5p	CLIP-seq
MIRT2248009	hsa-miR-4700-5p	CLIP-seq
MIRT2248010	hsa-miR-4710	CLIP-seq
MIRT2248011	hsa-miR-4744	CLIP-seq
MIRT1065813	hsa-miR-4768-3p	CLIP-seq
MIRT2248012	hsa-miR-4778-5p	CLIP-seq
MIRT2248013	hsa-miR-4792	CLIP-seq
MIRT2248014	hsa-miR-4799-5p	CLIP-seq
MIRT1065814	hsa-miR-513a-5p	CLIP-seq
MIRT2248015	hsa-miR-556-3p	CLIP-seq
MIRT2248016	hsa-miR-637	CLIP-seq
MIRT2248017	hsa-miR-761	CLIP-seq
MIRT2248018	hsa-miR-922	CLIP-seq
MIRT1065804	hsa-miR-3591-3p	CLIP-seq
MIRT2248005	hsa-miR-4299	CLIP-seq
MIRT2248010	hsa-miR-4710	CLIP-seq
MIRT2248013	hsa-miR-4792	CLIP-seq
MIRT2551748	hsa-miR-4637	CLIP-seq
MIRT2551749	hsa-miR-490-3p	CLIP-seq
MIRT2551750	hsa-miR-649	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 35271311
GO:0005737	Component	Cytoplasm	IDA	17068342
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006020	Process	Inositol metabolic process	IBA
GO:0006021	Process	Inositol biosynthetic process	IEA
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	9322233
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	9322233
GO:0008877	Function	Glucose-1-phosphatase activity	IEA
GO:0008934	Function	Inositol monophosphate 1-phosphatase activity	IBA
GO:0008934	Function	Inositol monophosphate 1-phosphatase activity	IDA	17068342
GO:0008934	Function	Inositol monophosphate 1-phosphatase activity	IEA
GO:0008934	Function	Inositol monophosphate 1-phosphatase activity	TAS	9322233
GO:0010226	Process	Response to lithium ion	IDA	15504365
GO:0016787	Function	Hydrolase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	17068342
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047954	Function	Glycerol-2-phosphatase activity	IEA
GO:0052832	Function	Inositol monophosphate 3-phosphatase activity	IEA
GO:0052833	Function	Inositol monophosphate 4-phosphatase activity	IEA
GO:0052834	Function	Inositol monophosphate phosphatase activity	IEA

MIM	HGNC	e!Ensembl
605922	6051	ENSG00000141401

O14732

Protein name

Inositol monophosphatase 2 (IMP 2) (IMPase 2) (EC 3.1.3.25) (Inositol-1(or 4)-monophosphatase 2) (Myo-inositol monophosphatase A2)

Protein function

Phosphatase that can use myo-inositol monophosphates, myo-inositol 1,4-diphosphate, scyllo-inositol-1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate and 2'-AMP as substrates in vitro (PubMed:17068342). It is likely that IMPA2 has an a

PDB

2CZH , 2CZI , 2CZK , 2DDK , 2FVZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00459	Inositol_P	16 → 282	Inositol monophosphatase family	Family

Sequence

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI
GFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDP
ATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIR
EAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Sequence length

288

Interactions

View interactions

	KEGG		Reactome
	Inositol phosphate metabolism Metabolic pathways Phosphatidylinositol signaling system		Synthesis of IP2, IP, and Ins in the cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEBRILE CONVULSIONS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES, FEBRILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	BEFREE	10822345, 11673796, 14699425, 15505643, 17251911, 17340635, 20153384, 20800640, 29499505		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	14699425, 17251911		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16841073, 17251911, 17340635, 20153384, 20800640		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	20800640	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	20800640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38048842	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	20800640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36740684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26889980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31202813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27661109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	17434096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASDB_DG	17434096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34743750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31202813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	16841073		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Febrile Convulsions	Febrile seizures	BEFREE	15557493, 17340635, 17388992		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Febrile Convulsions	Febrile seizures	CTD_human_DG	15557493		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	19647252, 27661109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19066393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	15505643		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	10822345, 14699425, 15505643		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	15505643		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	15505643		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	15505643		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	15505643		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	15505643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31202813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	16841073		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	11317223, 11673796		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	11673796, 16841073		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Diseases	Ovarian diseases	Pubtator	26889980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	26889980	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11317223, 27748550		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	11317223		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure, Febrile, Complex	Seizure	CTD_human_DG	15557493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Simple	Seizure	CTD_human_DG	15557493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32409648	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37140233	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

IMPA2 (inositol monophosphatase 2)