Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3611
Gene name	Integrin linked kinase
Gene symbol	ILK
Synonyms (NCBI Gene)	HEL-S-28ILK-1ILK-2P59p59ILK
Chromosome	11
Chromosome location	11p15.4
Summary	This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of t

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006720	hsa-miR-625-5p	ImmunoblotImmunohistochemistryLuciferase reporter assayqRT-PCR	22677169
MIRT007009	hsa-miR-542-3p	ImmunoblotImmunocytochemistryLuciferase reporter assay	21860426
MIRT007180	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	23104321
MIRT046790	hsa-miR-222-3p	CLASH	23622248
MIRT037481	hsa-miR-744-5p	CLASH	23622248
MIRT451921	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT451920	hsa-miR-889-5p	PAR-CLIP	23592263
MIRT451919	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT451918	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT451917	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT451916	hsa-miR-3179	PAR-CLIP	23592263
MIRT451915	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT451914	hsa-miR-3202	PAR-CLIP	23592263
MIRT451913	hsa-miR-711	PAR-CLIP	23592263
MIRT451912	hsa-miR-3652	PAR-CLIP	23592263
MIRT451911	hsa-miR-4430	PAR-CLIP	23592263
MIRT451910	hsa-miR-4505	PAR-CLIP	23592263
MIRT451909	hsa-miR-5787	PAR-CLIP	23592263
MIRT451908	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451907	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451906	hsa-miR-4271	PAR-CLIP	23592263
MIRT451905	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451904	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT006720	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451903	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451902	hsa-miR-5698	PAR-CLIP	23592263
MIRT451901	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451900	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451899	hsa-miR-4525	PAR-CLIP	23592263
MIRT451898	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451897	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT451896	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT451895	hsa-miR-1275	PAR-CLIP	23592263
MIRT451894	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT007009	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT007009	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT451921	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT451920	hsa-miR-889-5p	PAR-CLIP	23592263
MIRT451919	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT451918	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT451917	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT451916	hsa-miR-3179	PAR-CLIP	23592263
MIRT451915	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT451914	hsa-miR-3202	PAR-CLIP	23592263
MIRT451913	hsa-miR-711	PAR-CLIP	23592263
MIRT451912	hsa-miR-3652	PAR-CLIP	23592263
MIRT451911	hsa-miR-4430	PAR-CLIP	23592263
MIRT451910	hsa-miR-4505	PAR-CLIP	23592263
MIRT451909	hsa-miR-5787	PAR-CLIP	23592263
MIRT451908	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451907	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451906	hsa-miR-4271	PAR-CLIP	23592263
MIRT451905	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451904	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT006720	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451903	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451902	hsa-miR-5698	PAR-CLIP	23592263
MIRT451901	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451900	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451899	hsa-miR-4525	PAR-CLIP	23592263
MIRT451898	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451897	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT451896	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT451895	hsa-miR-1275	PAR-CLIP	23592263
MIRT451894	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT1065583	hsa-miR-31	CLIP-seq
MIRT1065584	hsa-miR-3688-5p	CLIP-seq
MIRT1065585	hsa-miR-4504	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq
MIRT2551684	hsa-miR-1225-3p	CLIP-seq
MIRT2551685	hsa-miR-1233	CLIP-seq
MIRT2551686	hsa-miR-128	CLIP-seq
MIRT2551687	hsa-miR-1908	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT2551688	hsa-miR-3612	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT2551689	hsa-miR-3921	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT2551690	hsa-miR-4303	CLIP-seq
MIRT2551691	hsa-miR-4443	CLIP-seq
MIRT2551692	hsa-miR-4536	CLIP-seq
MIRT2551693	hsa-miR-4653-5p	CLIP-seq
MIRT2551694	hsa-miR-4707-3p	CLIP-seq
MIRT2551695	hsa-miR-4749-3p	CLIP-seq
MIRT2551696	hsa-miR-625	CLIP-seq
MIRT2551697	hsa-miR-635	CLIP-seq
MIRT2551698	hsa-miR-650	CLIP-seq
MIRT2551699	hsa-miR-663	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq
MIRT2551684	hsa-miR-1225-3p	CLIP-seq
MIRT2551685	hsa-miR-1233	CLIP-seq
MIRT2551686	hsa-miR-128	CLIP-seq
MIRT2551687	hsa-miR-1908	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT2551688	hsa-miR-3612	CLIP-seq
MIRT2682818	hsa-miR-361-3p	CLIP-seq
MIRT2682819	hsa-miR-3679-3p	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT2551689	hsa-miR-3921	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT2551690	hsa-miR-4303	CLIP-seq
MIRT2551691	hsa-miR-4443	CLIP-seq
MIRT2551692	hsa-miR-4536	CLIP-seq
MIRT2551693	hsa-miR-4653-5p	CLIP-seq
MIRT2551694	hsa-miR-4707-3p	CLIP-seq
MIRT2551695	hsa-miR-4749-3p	CLIP-seq
MIRT2551696	hsa-miR-625	CLIP-seq
MIRT2551697	hsa-miR-635	CLIP-seq
MIRT2551698	hsa-miR-650	CLIP-seq
MIRT2551699	hsa-miR-663	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
ERG	Repression	23027626
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all (73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	20005845
GO:0000785	Component	Chromatin	IDA	17420447
GO:0000902	Process	Cell morphogenesis	IMP	30254023
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20005845, 21524996
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005178	Function	Integrin binding	IDA	20005845
GO:0005515	Function	Protein binding	IPI	11331308, 11331582, 12432066, 15817463, 16189514, 16936772, 17003112, 17553790, 18339839, 19074270, 20005845, 20926685, 21516116, 21643011, 22939624, 23414517, 23455922, 23877428, 25416956, 25502805, 25852190, 26496610, 26972000, 28514442, 30254023, 31515488, 32296183, 32707033, 339
GO:0005524	Function	ATP binding	IDA	20005845, 21524996
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	17420447
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17420447
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	18283114
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	30254023
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007052	Process	Mitotic spindle organization	IMP	18283114
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	TAS	8538749
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	9366252
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	ISS	20675382
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009967	Process	Positive regulation of signal transduction	IMP	10637513
GO:0010761	Process	Fibroblast migration	IEA
GO:0014044	Process	Schwann cell development	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	19118217
GO:0021675	Process	Nerve development	IEA
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0030017	Component	Sarcomere	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	21343177
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	19118217
GO:0042995	Component	Cell projection	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	21343177
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20018240
GO:0046872	Function	Metal ion binding	IEA
GO:0061351	Process	Neural precursor cell proliferation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0070836	Process	Caveola assembly	IEA
GO:0072697	Process	Protein localization to cell cortex	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	20018240
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IGI	30254023
GO:2000178	Process	Negative regulation of neural precursor cell proliferation	IEA

MIM	HGNC	e!Ensembl
602366	6040	ENSG00000166333

Q13418

Protein name

Scaffold protein ILK (ILK-1) (ILK-2) (Inactive integrin-linked kinase) (p59ILK)

Protein function

Scaffold protein which mediates protein-protein interactions during a range of cellular events including focal adhesion assembly, cell adhesion and cell migration (PubMed:17420447, PubMed:20005845, PubMed:30367047, PubMed:32528174). Regulates in

PDB

2KBX , 3F6Q , 3IXE , 3KMU , 3KMW , 3REP , 4HI8 , 4HI9 , 6MIB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13857	Ank_5	60 → 107		Repeat
PF12796	Ank_2	63 → 130	Ankyrin repeats (3 copies)	Repeat
PF07714	PK_Tyr_Ser-Thr	193 → 446	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart followed by skeletal muscle, pancreas and kidney. Weakly expressed in placenta, lung and liver.

Sequence

MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Sequence length

452

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Axon guidance Focal adhesion Bacterial invasion of epithelial cells Shigellosis Endometrial cancer		Localization of the PINCH-ILK-PARVIN complex to focal adhesions Cell-extracellular matrix interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cardiomyopathy	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular phenotype	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC POLYPS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ILK-related cardiomyopathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ILK-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Malignant tumor of esophagus	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary dilated cardiomyopathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary familial hypertrophic cardiomyopathy	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (184)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15870868, 23065574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15867245, 20091050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15870868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	23186335, 23729269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11244511, 11593435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	19478459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	19088848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	16093430		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27888145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	31843279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28546219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	19676046, 26286747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26286747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28546219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30120291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	20064661		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29250172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	BEFREE	19633364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	15073119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23783575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21351095, 21601006, 22570869, 23435415, 27683053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Stem Ischemia, Transient	Cerebral Ischemia	CTD_human_DG	15472100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11687976, 15467740, 21358264, 21680733, 23832543, 23840605, 28791358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23832543, 26905583, 27391337, 31296919, 31785406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18436335, 18722108, 21719054, 23784942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32315343	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11244511, 12596061, 23784942, 30575914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	30907484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29152644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21351095, 21601006, 22570869, 23435415, 27683053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	30575914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19176380, 23801886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26959113, 28097141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22814720, 27279483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23065574, 37746966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	17526737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15073119, 23026047, 28944870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17646580, 21602880, 29030401, 30463267, 30802431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	29030401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	17646580		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	15472100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	18722108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30726718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26837762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21806815, 24024606, 28794235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29496692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12771992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17072345, 20027603, 21339732, 23108908, 24360977, 29496692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12771992, 27099440, 29496692, 34249475, 36510452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35429970	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20605922, 30463267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17468516, 25657336, 31573329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18823942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18823942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	18823942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18823942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crescendo Transient Ischemic Attacks	Transient Ischemic Attack	CTD_human_DG	15472100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	23450431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	28522687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28237777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28237777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22665935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	35571621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	21752957, 23037158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	21688303, 24564279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	19478459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32315343, 36768775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30182767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30182767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36768775	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	20064661		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	20064661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	22616551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35587162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	12771992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Exudative Vitreoretinopathy	Exudative Vitreoretinopathy	BEFREE	31748531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	21928230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	21928230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23065574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	27315599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15105053, 15782140, 16546979, 23747271, 26460618, 28630423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26176204, 26460618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15105053, 15782140, 16546979, 23747271, 26460618, 28630423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18464290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22345562, 24045896, 25998224, 28138714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	24040439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	17088456, 24260102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20605922, 30463267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26837762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	30271655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31255599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29656700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17656471, 24383472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31653783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28188026		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17234779, 24590286, 26837762, 29903521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35485671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20193963, 29903521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21347395, 25805567, 29152644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29786754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12020426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19147542, 23801886, 25760437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15631637, 23832543, 25964055, 30575914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23065574	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	23045294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11687976, 15300800, 15467740, 21358264, 21680733, 23420345, 23832543, 23840605, 28791358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	23065574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	30575914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29787808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23801886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15073119, 23026047, 28944870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20091050, 26616862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12631621, 15782140, 18339839, 20838383, 23783575, 24497940, 25450398, 30250560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12596061, 21941415, 24502999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26549818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	23707970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21351095, 21601006, 22570869, 23435415, 27683053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12771992, 15073119, 15300800, 16546979, 17143519, 17187779, 18339839, 19633364, 19895269, 20027603, 20091050, 20495362, 21347395, 21351095, 23108908 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29496692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20565980, 29608014		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14555513, 17575101		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21278793, 24064223, 24157826, 28188308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24157826, 32305668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19781955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	36768775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22658851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29656700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	25589244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28565779, 30814673, 31815595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28565779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	16840719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24361375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10341284, 10716737, 11687976, 11704830, 12596061, 12631621, 12771992, 15300800, 15313908, 15467740, 18436335, 18496706, 19334037, 19478459, 19895269 View all (32 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21719054, 29695398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29695398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19147542, 19176380, 23801886, 30473379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30835508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23237804	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23784942, 30636169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23784942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15073119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	15073119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	32945993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12642872, 15073119, 16648553, 17187779		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15073119, 23026047, 28944870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23099104, 26959113, 28944870, 35379775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20091050, 26616862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16407822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26616862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15867245, 23764046, 27936345, 37477162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	29608014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	28522687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	28522687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	15472100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	18926819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10716737, 12631621, 15782140, 18339839, 20838383, 23783575, 24497940, 25450398, 30250560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10716737, 24497940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12771992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12771992	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17468516, 25657336, 31573329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17468516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	19541809, 30657569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21234586, 24911651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	24911651, 26176204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	19478459, 20495362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19478459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	12771992	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26531674, 29250172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31579417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30575914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12596061, 21941415, 23317227, 23748822, 24502999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16987993, 23317227, 35778385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic Diseases	CTD_human_DG	23045294		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26549818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26549818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26549818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	CTD_human_DG	15472100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	15472100		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Ischemic Attack, Anterior Circulation	Transient Ischemic Attack	CTD_human_DG	15472100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack, Vertebrobasilar Circulation	Transient Ischemic Attack	CTD_human_DG	15472100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	20864366, 22938462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20027603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27683053, 35039759, 39508245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34381164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ILK (integrin linked kinase)