AQP4 (aquaporin 4)

Gene

• Entrez ID: 361
• Gene name: Aquaporin 4
• Gene symbol: AQP4
• Synonyms (NCBI Gene): MIWC, MLC4, WCH4, hAQP4
• Chromosome: 18
• Chromosome location: 18q11.2
• Summary: This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1555661648	C>G	Likely-pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006498	hsa-miR-320a	Luciferase reporter assay	20628061
MIRT006498	hsa-miR-320a	Luciferase reporter assay	20628061
MIRT006498	hsa-miR-320a	Luciferase reporter assay	20628061
MIRT731925	hsa-miR-29b-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26126866
MIRT731925	hsa-miR-29b-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26126866
MIRT732776	hsa-miR-216a-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33817241
MIRT732820	hsa-miR-196b-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33455522
MIRT734410	hsa-miR-146a-3p	Luciferase reporter assay, qRT-PCR	33192260
MIRT791507	hsa-miR-106a	CLIP-seq
MIRT791508	hsa-miR-106b	CLIP-seq
MIRT791509	hsa-miR-142-5p	CLIP-seq
MIRT791510	hsa-miR-17	CLIP-seq
MIRT791511	hsa-miR-20a	CLIP-seq
MIRT791512	hsa-miR-20b	CLIP-seq
MIRT791513	hsa-miR-24	CLIP-seq
MIRT791514	hsa-miR-3149	CLIP-seq
MIRT791515	hsa-miR-3174	CLIP-seq
MIRT791516	hsa-miR-3609	CLIP-seq
MIRT791517	hsa-miR-3659	CLIP-seq
MIRT791518	hsa-miR-4280	CLIP-seq
MIRT791519	hsa-miR-4330	CLIP-seq
MIRT791520	hsa-miR-4658	CLIP-seq
MIRT791521	hsa-miR-4662a-3p	CLIP-seq
MIRT791522	hsa-miR-4796-3p	CLIP-seq
MIRT791523	hsa-miR-519d	CLIP-seq
MIRT791524	hsa-miR-548ah	CLIP-seq
MIRT791525	hsa-miR-548n	CLIP-seq
MIRT791526	hsa-miR-548t	CLIP-seq
MIRT791527	hsa-miR-574-5p	CLIP-seq
MIRT791528	hsa-miR-629	CLIP-seq
MIRT791529	hsa-miR-651	CLIP-seq
MIRT791530	hsa-miR-758	CLIP-seq
MIRT791531	hsa-miR-93	CLIP-seq
MIRT791532	hsa-miR-3591-3p	CLIP-seq
MIRT791533	hsa-miR-3662	CLIP-seq
MIRT791534	hsa-miR-4427	CLIP-seq
MIRT791535	hsa-miR-450b-5p	CLIP-seq
MIRT791536	hsa-miR-4680-3p	CLIP-seq
MIRT791537	hsa-miR-518a-5p	CLIP-seq
MIRT791538	hsa-miR-520d-5p	CLIP-seq
MIRT791539	hsa-miR-524-5p	CLIP-seq
MIRT791540	hsa-miR-527	CLIP-seq
MIRT1933493	hsa-miR-1256	CLIP-seq
MIRT1933494	hsa-miR-3652	CLIP-seq
MIRT1933495	hsa-miR-4430	CLIP-seq
MIRT1933496	hsa-miR-4505	CLIP-seq
MIRT1933497	hsa-miR-4642	CLIP-seq
MIRT1933498	hsa-miR-4760-3p	CLIP-seq
MIRT2173560	hsa-miR-4533	CLIP-seq
MIRT2173561	hsa-miR-579	CLIP-seq
MIRT2464859	hsa-miR-2355-5p	CLIP-seq
MIRT2464860	hsa-miR-4328	CLIP-seq
MIRT2464861	hsa-miR-4668-3p	CLIP-seq
MIRT791538	hsa-miR-520d-5p	CLIP-seq
MIRT791539	hsa-miR-524-5p	CLIP-seq
MIRT2464862	hsa-miR-605	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003091	Process	Renal water homeostasis	TAS
GO:0005515	Function	Protein binding	IPI	25910212, 28734904, 31286866, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	18392839
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8601457, 16814974, 37143309
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006833	Process	Water transport	IBA
GO:0006833	Process	Water transport	IDA	8601457, 19383790
GO:0009897	Component	External side of plasma membrane	IDA	17645239
GO:0009992	Process	Intracellular water homeostasis	IEA
GO:0009992	Process	Intracellular water homeostasis	IMP	37143309
GO:0009992	Process	Intracellular water homeostasis	ISS
GO:0010008	Component	Endosome membrane	IEA
GO:0015250	Function	Water channel activity	EXP	17178220, 18511455
GO:0015250	Function	Water channel activity	IBA
GO:0015250	Function	Water channel activity	IDA	8601457, 19383790
GO:0015250	Function	Water channel activity	IEA
GO:0015250	Function	Water channel activity	IMP	37143309
GO:0015267	Function	Channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0042383	Component	Sarcolemma	IDA	29055082
GO:0042383	Component	Sarcolemma	IEA
GO:0042802	Function	Identical protein binding	IPI	19383790
GO:0042995	Component	Cell projection	IEA
GO:0050891	Process	Multicellular organismal-level water homeostasis	IEP	16814974, 17645239
GO:0050891	Process	Multicellular organismal-level water homeostasis	ISS
GO:0051289	Process	Protein homotetramerization	IDA	19383790
GO:0055085	Process	Transmembrane transport	IEA
GO:0071346	Process	Cellular response to type II interferon	IDA	17645239
GO:0090660	Process	Cerebrospinal fluid circulation	ISS
GO:0097450	Component	Astrocyte end-foot	ISS

Other IDs

• MIM: 600308
• HGNC: 637
• e!Ensembl: ENSG00000171885

Protein

• UniProt ID: P55087
• Protein name: Aquaporin-4 (AQP-4) (Mercurial-insensitive water channel) (MIWC) (WCH4)
• Protein function: Forms a water-specific channel (PubMed:19383790, PubMed:7559426, PubMed:8601457). Plays an important role in brain water homeostasis (PubMed:37143309). It is involved in glymphatic solute transport and is required for a normal rate of water exch
• PDB: 3GD8, 8V8S, 8V91, 8V9D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00230	MIP	29 → 248	Major intrinsic protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in skeletal muscle (PubMed:29055082). Detected in stomach, along the glandular base region of the fundic gland (at protein level) (PubMed:8601457). Detected in brain, lung and skeletal muscle, and at much lower levels in heart
• Sequence:

  MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWG
  GTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIA
  AQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDS
  KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
  AVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH
  VIDVDRGEEKKGKDQSGEVLSSV

• Sequence length: 323

Pathways

KEGG:

Vasopressin-regulated water reabsorption
Bile secretion

Reactome:

Vasopressin regulates renal water homeostasis via Aquaporins
Passive transport by Aquaporins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Intellectual disability	Likely pathogenic	rs1555661648	RCV000515759	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Megalencephalic leukoencephalopathy with subcortical cysts 4, remitting	Pathogenic	rs148498248	RCV003315379	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AQP4-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLINDNESS AND LOW VISION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENIERE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEURITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	20461409		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21548930, 31060025, 31655267		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Agenesis of Corpus Callosum	Corpus callosum agenesis	Pubtator	35346374	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21107133	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26919570, 30475760, 34597351, 35695802, 37191905, 39208715, 39603277	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30120299	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27893874, 29479071, 31371497, 31746246		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15200272, 19089902, 22987392, 28274814, 28627708, 29154923, 30980198		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	29390462		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	22171929	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	28326889		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28265203		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11796780, 15593389, 26954804, 29485906, 30940654, 37053041	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17335082, 19153045, 20937947, 22328087, 27483250, 29485906		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	17335082		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36295481	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	18435417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18435417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	18435417	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17439988, 19372295, 20541774, 24733266, 27371173, 27671902, 28017203, 28027883, 28058717, 28293214, 28326889, 28716289, 28872108, 29055457, 29311561, 29387055, 29951558, 29988553, 30342072, 30475082, 30531019, 30635724, 30691235, 30724768, 30769213, 31242419, 31566079, 31726278		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	27054574		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	28926419		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29375693		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	35806122	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31812041		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29655487		★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	17347837		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	11796780, 22171929, 39208715	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	14645363, 21968684, 24164438, 24999750, 30563176, 31039748, 37053041, 37143309	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	27623738	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	15593389, 24999750, 30423808	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15561416, 17335082, 19153045, 20965731, 21424125, 23950863, 28258567, 30877104		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15593389, 37053041, 37722850	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27516192, 30771577		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27516192, 37053041	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	24733266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31812041		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35245343	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28688153		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	18838545	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	21107133	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	28222512		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	32059400	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	BEFREE	29485906		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	22334710, 26126866, 28402976, 28752625, 29153303, 30093197		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26013827, 26767580, 28274814, 28490769, 28523299, 30353860, 30818045, 30855407, 31077714, 31374325, 31382635, 31672489		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28906027		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	20871402, 26616866, 29521337, 30284401, 31383359		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27940353		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32369477, 37191905	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29144890		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	20886625		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	27884934, 28427704, 29988553, 30144694, 30919512		★☆☆☆☆ Found in Text Mining only
Continuous spike and waves during slow sleep	Continuous spike and waves during slow sleep	BEFREE	29654708		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31512641		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	22714714		★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	17899684		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	27506782		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	LHGDN	16778375		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	17468440, 19140826, 19938104, 23116879, 23746426, 24361961, 25128605, 25895050, 28212662, 28258578, 28420330, 28477975, 28840314, 29073350, 29280091, 29320331, 29856157, 30149303, 30284401, 30508889, 30851734, 30993677, 31272070, 31503075, 31743235		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	21241398, 29468668, 35806122	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	24422972		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	27837334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	33629286	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37400893	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33629286, 35262732, 35528520	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	21241398	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	22540328	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17984171		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	17984171		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	28926419		★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium Syndrome	BEFREE	18309154		★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Dysferlinopathy	BEFREE	18392839		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29288747, 29351212		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	21968684	Stimulate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	22714714, 33538957, 35260880	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	22011386, 28533781, 29131884, 29414288, 29449936, 29793504, 30133068, 30590238, 31398657		★☆☆☆☆ Found in Text Mining only
Encephalomyelitis Acute Disseminated	Acute disseminated encephalomyelitis	Pubtator	33597947	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22378467, 22714714, 30022509		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	22714714, 27864825, 33297722, 37053041	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	22698689, 27864825, 31321953	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	15517312, 19864112, 27864825, 31078684, 31321953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28601284		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28601284		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34329340	Associate	★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	28125740	Associate	★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	22808259		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	34838088	Associate	★☆☆☆☆ Found in Text Mining only
Fukuyama Type Congenital Muscular Dystrophy	Fukuyama Type Congenital Muscular Dystrophy	BEFREE	12942324		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	12618402, 23464865		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	29847670	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17335082, 21424125, 22472177, 22714714, 23950863, 25204262, 30275445, 30873889, 31019448, 31746080		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17628813, 22714714, 22773464, 30275445, 35187599, 36599974, 37722850	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21424125, 22472177, 22714714, 23950863, 25204262, 30275445, 30873889, 31019448, 31746080		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17335082, 17549682, 19761816, 23915916, 27823947, 28423683, 29390462, 29484417, 30877104, 31160309, 31803626		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17549682		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17549682, 22773464, 36599974	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	20886625		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	22808259		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	22808259	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27749786		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36295481	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30201461		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	16552421, 29921834, 29982881, 30293570, 31200081, 31470163, 31556577		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	28212403, 34597351, 35346374	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	30353860, 31156164		★☆☆☆☆ Found in Text Mining only
Hypercapnia	Hypercapnia	Pubtator	36056566	Associate	★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	25128605		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29793504		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30593981		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36056566	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29234383		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27940353, 29067342, 31441374		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33528024	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30771577		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30914277		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26126866, 29057271, 29072508, 29295526, 29692268, 30592266, 30628716, 31672489		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29602131		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	29676204		★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	34082828	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	16871401		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	LHGDN	16871401		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28165501		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	24164438	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	24164438		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	32369477	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29414297		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20463974	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26616866, 28326889, 31213132, 31566079, 31578302, 31621483, 31679449		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31302522		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	22714714	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28423683, 30877104		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25204262		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27516192, 30771577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28601284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31674022		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22808259		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31812041		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27483250, 28423683, 28920766, 31160309		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31030016		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	20461409, 23352976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere Disease	Meniere disease	Pubtator	20461409	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	19153045, 21968684, 27357591, 27552812		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21968684	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	18923397, 24422972		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	27837334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	31321953		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	19209385		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	28627708, 30980198		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16778375, 18437047		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17439988, 20028711, 21130504, 21241398, 21654846, 23142234, 24361961, 24832354, 27063619, 27082714, 27788675, 27844165, 27951522, 28262035, 28274814, 28340598, 28364548, 28427704, 28445879, 28461494, 28477397, 28533781, 28615429, 28851393, 28859212, 29141789, 29153600, 29388807, 29512413, 29521337, 29716788, 29724224, 29806512, 29856157, 29875186, 29904379, 29972029, 30144694, 30284401, 30319524, 30364209, 30447856, 30537075, 30544111, 30559466, 30575890, 30590238, 30711604, 30819213, 30962374, 31028519, 31124748, 31152967, 31209474, 31304648, 31364464, 31425702, 31433309, 31566925, 31707235, 31715457, 31743235, 31752329, 31824807		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21241398, 21654846, 27788675, 33297722, 35360267	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	29208041		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	LHGDN	18641458		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	LHGDN	18392839		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	11890849, 15200272, 18392839		★☆☆☆☆ Found in Text Mining only
MUSCULAR DYSTROPHY, LIMB-GIRDLE, TYPE 2B	Limb-Girdle Muscular Dystrophy	BEFREE	18392839		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	20728226, 28326889, 29312313, 29951558		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28688153		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30423808	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15561416, 17347837, 19761816, 22714714, 24733266, 25342397, 26603163, 27552812, 28423683, 31080825, 31803626		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	26261083		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	26261083	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	23142234, 24164438, 24582793, 26616866, 27054574, 29072508, 29405337, 29875186, 30057582		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	27506782		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26919570, 32369477	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26919570, 30980198, 31156164		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	24733266		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	16087714, 17439988, 17468440, 18510734, 18838545, 19140826, 19372295, 19410301, 19740485, 19752309, 19938104, 20227773, 20660861, 20728226, 20880299, 20937947, 21130504, 21212277, 21241398, 21300379, 21454592, 21463872, 21491501, 21621278, 21621279, 21900637, 21909659, 22069320, 22118860, 22248325, 22394609, 22526022, 22526930, 22580368, 22807325, 23008451, 23116879, 23142234, 23202933, 23378324, 23664693, 23689970, 23707078, 23809190, 23857303, 24083534, 24190619, 24260168, 24263387, 24361961, 24374258, 24655566, 24698947, 24733266, 25074611, 25096173, 25128605, 25239624, 25575677, 25839357, 25895050, 26287441, 26423139, 26521232, 26530185, 26616866, 27012886, 27049564, 27054574, 27063619, 27082714, 27371173, 27553618, 27572864, 27613120, 27622909, 27671902, 27682231, 27696784, 27758954, 27788675, 27838939, 27844165, 27884934, 27885065, 27951522, 28027883, 28057643, 28058717, 28058965, 28068933, 28071581, 28079804, 28104255, 28131170, 28184993, 28199381, 28212662, 28226075, 28248700, 28258567, 28258578, 28262035, 28271642, 28274814, 28293214, 28302609, 28306572, 28326889, 28340598, 28364548, 28385199, 28391784, 28404667, 28413701, 28420330, 28427704, 28445879, 28461494, 28476558, 28477975, 28533781, 28542592, 28567523, 28572277, 28580873, 28589164, 28601284, 28601290, 28615429, 28619428, 28670343, 28679367, 28679661, 28684532, 28750658, 28803524, 28840314, 28851393, 28857723, 28859212, 28872108, 28879451, 28920766, 28955334, 28968830, 28984163, 28987175, 28991690, 29055082, 29055448, 29055457, 29055475, 29073350, 29123400, 29131884, 29133107, 29137920, 29141789, 29141819, 29141825, 29141830, 29144890, 29153600, 29154728, 29208041, 29249386, 29280091, 29285152, 29291482, 29297041, 29311561, 29312313, 29320331, 29339316, 29349658, 29359475, 29361915, 29387055, 29388807, 29390462, 29406904, 29414288, 29414297, 29447335, 29449281, 29455827, 29465432, 29504295, 29512413, 29514948, 29571847, 29623106, 29654708, 29655487, 29670575, 29676196, 29676204, 29685427, 29688841, 29703264, 29721683, 29724224, 29748202, 29769526, 29794010, 29806512, 29856157, 29875186, 29904379, 29913164, 29951558, 29972029, 29973905, 29988553, 30004999, 30011409, 30015656, 30021816, 30049802, 30056360, 30056361, 30057582, 30077551, 30083159, 30144694, 30147671, 30149303, 30196259, 30217177, 30248527, 30258024, 30284401, 30293882, 30300851, 30319524, 30342072, 30348195, 30408708, 30426010, 30447856, 30475082, 30500945, 30508889, 30513364, 30530071, 30544111, 30554040, 30555462, 30559466, 30564980, 30590238, 30593981, 30623348, 30623860, 30635724, 30648122, 30671648, 30690341, 30691235, 30711604, 30716473, 30722721, 30743086, 30762607, 30769213, 30771577, 30797593, 30800132, 30819213, 30824481, 30825702, 30841862, 30851543, 30851734, 30878968, 30884276, 30891765, 30893099, 30904690, 30913570, 30934923, 30935410, 30938427, 30954932, 30958797, 30962374, 30981191, 30981824, 31028519, 31030016, 31041694, 31050279, 31056665, 31118222, 31124748, 31127016, 31171648, 31178306, 31187587, 31200081, 31221630, 31232925, 31236596, 31242419, 31272070, 31276911, 31296268, 31353503, 31376237, 31398657, 31425702, 31474831, 31566079, 31566925, 31578302, 31582425, 31587392, 31621483, 31636597, 31654702, 31655267, 31655825, 31679449, 31680620, 31695085, 31700746, 31706113, 31707235, 31715457, 31726278, 31729806, 31731214, 31743235, 31748853, 31752329, 31773369, 31774956, 31786498, 31803192, 31812041, 31812873, 31824807, 31847043		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	LHGDN	16778375, 16831965, 18462810, 18510734, 18516975		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	CTD_human_DG	18509235, 24070676		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	29073350, 31578302		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	20886625		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21548930, 31695842		★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28803524		★☆☆☆☆ Found in Text Mining only
Obstructive Hydrocephalus	Obstructive Hydrocephalus	BEFREE	17347837		★☆☆☆☆ Found in Text Mining only
Oculomotor Nerve Paralysis	Oculomotor nerve palsy	BEFREE	31178306		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	31371497		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	24263387		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	24374258, 27668553, 27749786, 27788675, 28057643, 28199381, 28293214, 28404667, 28477397, 28533781, 28684532, 28859212, 28863861, 28879451, 28991690, 29055448, 29101456, 29153600, 29363529, 29387055, 29470571, 29504295, 29778487, 29972029, 29995195, 30004610, 30004999, 30021816, 30049802, 30364209, 30405519, 30508889, 30522039, 30576847, 30716473, 31061727, 31118222, 31196727, 31213132, 31232925, 31276911, 31364464, 31371497, 31503075		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuritis	Optic neuritis	Pubtator	24415568, 28125740, 29798830, 31568704, 34272440, 36969199	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuropathy	Optic Neuropathy	BEFREE	28272192, 29716788		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30628716		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36736467	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29472315	Associate	★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	31196727		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	31706113		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	19571450	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26919570, 28274814, 28735099, 30680924, 31127615		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26919570, 36736467, 37032643	Associate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	20886625		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	17335082		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	30258024		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	31039748		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28212403		★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	BEFREE	21914143, 28733756, 29477544		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31321953		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31512641		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29602131		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29608911		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28940930		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29655487		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16194264, 22544010, 30618856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16194264, 22544010		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34969953	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	22714714	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	25082552		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29449936		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	28648105	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28601284		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	20886625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	20886625		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31674022		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	19112001	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19112001	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29678898	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	LHGDN	14753493		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27031957, 29592873, 31556577, 31833035		★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	BEFREE	30301458		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31706113		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	30954932		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	20728226		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22808259		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	27749786		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22808259		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22808259	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	22808259	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	26767580		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	26767580		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	28432042, 31726278		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28924212		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31078684		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	22808259		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31302522		★☆☆☆☆ Found in Text Mining only