Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	3609
Gene name	Interleukin enhancer binding factor 3
Gene symbol	ILF3
Synonyms (NCBI Gene)	CBTFDRBFDRBP76MMP4MPHOSPH4MPP4MPP4110NF-AT-90NF110NF110bNF90NF90aNF90bNF90cNF90ctvNFARNFAR-1NFAR-2NFAR110NFAR2NFAR90TCP110TCP80
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein (NF90, ILF3) forms a heterodimer with a 45 kDa transc

235

Show/Hide all (235)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025730	hsa-miR-7-5p	Microarray	19073608
MIRT050983	hsa-miR-17-5p	CLASH	23622248
MIRT045490	hsa-miR-149-5p	CLASH	23622248
MIRT045018	hsa-miR-186-5p	CLASH	23622248
MIRT045018	hsa-miR-186-5p	CLASH	23622248
MIRT044800	hsa-miR-320a	CLASH	23622248
MIRT044381	hsa-miR-200c-3p	CLASH	23622248
MIRT041999	hsa-miR-484	CLASH	23622248
MIRT040678	hsa-miR-92b-3p	CLASH	23622248
MIRT040110	hsa-miR-615-3p	CLASH	23622248
MIRT039142	hsa-miR-769-5p	CLASH	23622248
MIRT039142	hsa-miR-769-5p	CLASH	23622248
MIRT037927	hsa-miR-532-3p	CLASH	23622248
MIRT036091	hsa-miR-1296-5p	CLASH	23622248
MIRT025730	hsa-miR-7-5p	MicroarrayNorthern blotqRT-PCRWestern blot	27519414
MIRT1065468	hsa-miR-1305	CLIP-seq
MIRT1065469	hsa-miR-3940-5p	CLIP-seq
MIRT1065470	hsa-miR-4507	CLIP-seq
MIRT1065471	hsa-miR-4716-3p	CLIP-seq
MIRT1065472	hsa-miR-4723-5p	CLIP-seq
MIRT1065473	hsa-miR-4728-5p	CLIP-seq
MIRT1065474	hsa-miR-548an	CLIP-seq
MIRT1065475	hsa-miR-598	CLIP-seq
MIRT1065476	hsa-miR-629	CLIP-seq
MIRT1065477	hsa-miR-95	CLIP-seq
MIRT1065478	hsa-miR-101	CLIP-seq
MIRT1065479	hsa-miR-1237	CLIP-seq
MIRT1065480	hsa-miR-1245b-3p	CLIP-seq
MIRT1065481	hsa-miR-1254	CLIP-seq
MIRT1065482	hsa-miR-1273e	CLIP-seq
MIRT1065483	hsa-miR-1291	CLIP-seq
MIRT1065484	hsa-miR-136	CLIP-seq
MIRT1065485	hsa-miR-144	CLIP-seq
MIRT1065486	hsa-miR-1470	CLIP-seq
MIRT1065487	hsa-miR-150	CLIP-seq
MIRT1065488	hsa-miR-188-5p	CLIP-seq
MIRT1065489	hsa-miR-1908	CLIP-seq
MIRT1065490	hsa-miR-1912	CLIP-seq
MIRT1065491	hsa-miR-1913	CLIP-seq
MIRT1065492	hsa-miR-1915	CLIP-seq
MIRT1065493	hsa-miR-202	CLIP-seq
MIRT1065494	hsa-miR-2116	CLIP-seq
MIRT1065495	hsa-miR-2276	CLIP-seq
MIRT1065496	hsa-miR-2277-3p	CLIP-seq
MIRT1065497	hsa-miR-2861	CLIP-seq
MIRT1065498	hsa-miR-3116	CLIP-seq
MIRT1065499	hsa-miR-3135	CLIP-seq
MIRT1065500	hsa-miR-3140-3p	CLIP-seq
MIRT1065501	hsa-miR-3140-5p	CLIP-seq
MIRT1065502	hsa-miR-3144-5p	CLIP-seq
MIRT1065503	hsa-miR-3151	CLIP-seq
MIRT1065504	hsa-miR-3163	CLIP-seq
MIRT1065505	hsa-miR-3173-5p	CLIP-seq
MIRT1065506	hsa-miR-3174	CLIP-seq
MIRT1065507	hsa-miR-3180	CLIP-seq
MIRT1065508	hsa-miR-3180-3p	CLIP-seq
MIRT1065509	hsa-miR-3182	CLIP-seq
MIRT1065510	hsa-miR-3192	CLIP-seq
MIRT1065511	hsa-miR-3196	CLIP-seq
MIRT1065512	hsa-miR-323-5p	CLIP-seq
MIRT1065513	hsa-miR-324-3p	CLIP-seq
MIRT1065514	hsa-miR-324-5p	CLIP-seq
MIRT1065515	hsa-miR-340	CLIP-seq
MIRT1065516	hsa-miR-3607-3p	CLIP-seq
MIRT1065517	hsa-miR-3618	CLIP-seq
MIRT1065518	hsa-miR-3657	CLIP-seq
MIRT1065519	hsa-miR-3665	CLIP-seq
MIRT1065520	hsa-miR-3680	CLIP-seq
MIRT1065521	hsa-miR-3686	CLIP-seq
MIRT1065522	hsa-miR-3689d	CLIP-seq
MIRT1065523	hsa-miR-3918	CLIP-seq
MIRT1065524	hsa-miR-3922-5p	CLIP-seq
MIRT1065525	hsa-miR-3929	CLIP-seq
MIRT1065526	hsa-miR-3942-3p	CLIP-seq
MIRT1065527	hsa-miR-412	CLIP-seq
MIRT1065528	hsa-miR-4254	CLIP-seq
MIRT1065529	hsa-miR-4273	CLIP-seq
MIRT1065530	hsa-miR-4286	CLIP-seq
MIRT1065531	hsa-miR-4419b	CLIP-seq
MIRT1065532	hsa-miR-4420	CLIP-seq
MIRT1065533	hsa-miR-4422	CLIP-seq
MIRT1065534	hsa-miR-4443	CLIP-seq
MIRT1065535	hsa-miR-4446-5p	CLIP-seq
MIRT1065536	hsa-miR-4454	CLIP-seq
MIRT1065537	hsa-miR-4469	CLIP-seq
MIRT1065538	hsa-miR-4478	CLIP-seq
MIRT1065539	hsa-miR-4488	CLIP-seq
MIRT1065540	hsa-miR-4512	CLIP-seq
MIRT1065541	hsa-miR-4524	CLIP-seq
MIRT1065542	hsa-miR-4640-5p	CLIP-seq
MIRT1065543	hsa-miR-4643	CLIP-seq
MIRT1065544	hsa-miR-4650-5p	CLIP-seq
MIRT1065545	hsa-miR-4661-5p	CLIP-seq
MIRT1065546	hsa-miR-4667-3p	CLIP-seq
MIRT1065547	hsa-miR-4672	CLIP-seq
MIRT1065548	hsa-miR-4677-5p	CLIP-seq
MIRT1065549	hsa-miR-4678	CLIP-seq
MIRT1065550	hsa-miR-4685-5p	CLIP-seq
MIRT1065551	hsa-miR-4690-3p	CLIP-seq
MIRT1065552	hsa-miR-4690-5p	CLIP-seq
MIRT1065553	hsa-miR-4697-5p	CLIP-seq
MIRT1065554	hsa-miR-4708-3p	CLIP-seq
MIRT1065555	hsa-miR-4719	CLIP-seq
MIRT1065556	hsa-miR-4726-5p	CLIP-seq
MIRT1065557	hsa-miR-4728-3p	CLIP-seq
MIRT1065558	hsa-miR-4738-3p	CLIP-seq
MIRT1065559	hsa-miR-4749-3p	CLIP-seq
MIRT1065560	hsa-miR-4753-5p	CLIP-seq
MIRT1065561	hsa-miR-4755-3p	CLIP-seq
MIRT1065562	hsa-miR-4757-3p	CLIP-seq
MIRT1065563	hsa-miR-4760-3p	CLIP-seq
MIRT1065564	hsa-miR-4763-5p	CLIP-seq
MIRT1065565	hsa-miR-4764-3p	CLIP-seq
MIRT1065566	hsa-miR-494	CLIP-seq
MIRT1065567	hsa-miR-495	CLIP-seq
MIRT1065568	hsa-miR-502-5p	CLIP-seq
MIRT1065569	hsa-miR-5096	CLIP-seq
MIRT1065570	hsa-miR-513b	CLIP-seq
MIRT1065571	hsa-miR-515-5p	CLIP-seq
MIRT1065572	hsa-miR-518a-5p	CLIP-seq
MIRT1065573	hsa-miR-527	CLIP-seq
MIRT1065574	hsa-miR-548a-3p	CLIP-seq
MIRT1065575	hsa-miR-548e	CLIP-seq
MIRT1065576	hsa-miR-548f	CLIP-seq
MIRT1065577	hsa-miR-548g	CLIP-seq
MIRT1065578	hsa-miR-615-5p	CLIP-seq
MIRT1065579	hsa-miR-642a	CLIP-seq
MIRT1065580	hsa-miR-663	CLIP-seq
MIRT1065581	hsa-miR-759	CLIP-seq
MIRT1065582	hsa-miR-876-3p	CLIP-seq
MIRT1065475	hsa-miR-598	CLIP-seq
MIRT2247881	hsa-miR-1184	CLIP-seq
MIRT2247882	hsa-miR-1205	CLIP-seq
MIRT2247883	hsa-miR-1289	CLIP-seq
MIRT2247884	hsa-miR-1301	CLIP-seq
MIRT1065468	hsa-miR-1305	CLIP-seq
MIRT2247885	hsa-miR-1343	CLIP-seq
MIRT2247886	hsa-miR-147	CLIP-seq
MIRT2247887	hsa-miR-155	CLIP-seq
MIRT2247888	hsa-miR-15a	CLIP-seq
MIRT2247889	hsa-miR-15b	CLIP-seq
MIRT2247890	hsa-miR-16	CLIP-seq
MIRT2247891	hsa-miR-195	CLIP-seq
MIRT2247892	hsa-miR-19a	CLIP-seq
MIRT2247893	hsa-miR-19b	CLIP-seq
MIRT2247894	hsa-miR-208a	CLIP-seq
MIRT2247895	hsa-miR-208b	CLIP-seq
MIRT2247896	hsa-miR-2113	CLIP-seq
MIRT2247897	hsa-miR-3065-3p	CLIP-seq
MIRT2247898	hsa-miR-3074-5p	CLIP-seq
MIRT2247899	hsa-miR-3119	CLIP-seq
MIRT2247900	hsa-miR-3122	CLIP-seq
MIRT1065500	hsa-miR-3140-3p	CLIP-seq
MIRT2247901	hsa-miR-3152-5p	CLIP-seq
MIRT2247902	hsa-miR-3158-5p	CLIP-seq
MIRT2247903	hsa-miR-3160-5p	CLIP-seq
MIRT2247904	hsa-miR-3198	CLIP-seq
MIRT2247905	hsa-miR-3611	CLIP-seq
MIRT2247906	hsa-miR-3688-5p	CLIP-seq
MIRT2247907	hsa-miR-3689a-3p	CLIP-seq
MIRT2247908	hsa-miR-3689c	CLIP-seq
MIRT2247909	hsa-miR-3692	CLIP-seq
MIRT2247910	hsa-miR-3910	CLIP-seq
MIRT2247911	hsa-miR-3913-5p	CLIP-seq
MIRT2247912	hsa-miR-424	CLIP-seq
MIRT2247913	hsa-miR-4294	CLIP-seq
MIRT2247914	hsa-miR-4309	CLIP-seq
MIRT2247915	hsa-miR-4312	CLIP-seq
MIRT2247916	hsa-miR-4417	CLIP-seq
MIRT2247917	hsa-miR-4432	CLIP-seq
MIRT2247918	hsa-miR-4434	CLIP-seq
MIRT2247919	hsa-miR-4436b-5p	CLIP-seq
MIRT2247920	hsa-miR-4516	CLIP-seq
MIRT2247921	hsa-miR-4530	CLIP-seq
MIRT2247922	hsa-miR-4660	CLIP-seq
MIRT2247923	hsa-miR-4691-3p	CLIP-seq
MIRT2247924	hsa-miR-4774-3p	CLIP-seq
MIRT2247925	hsa-miR-4774-5p	CLIP-seq
MIRT2247926	hsa-miR-497	CLIP-seq
MIRT2247927	hsa-miR-499-3p	CLIP-seq
MIRT2247928	hsa-miR-499-5p	CLIP-seq
MIRT2247929	hsa-miR-499a-3p	CLIP-seq
MIRT2247930	hsa-miR-5047	CLIP-seq
MIRT2247931	hsa-miR-541	CLIP-seq
MIRT2247932	hsa-miR-548a-5p	CLIP-seq
MIRT2247933	hsa-miR-548ab	CLIP-seq
MIRT2247934	hsa-miR-548ak	CLIP-seq
MIRT1065474	hsa-miR-548an	CLIP-seq
MIRT2247935	hsa-miR-548b-3p	CLIP-seq
MIRT2247936	hsa-miR-548b-5p	CLIP-seq
MIRT2247937	hsa-miR-548c-5p	CLIP-seq
MIRT2247938	hsa-miR-548d-5p	CLIP-seq
MIRT2247939	hsa-miR-548h	CLIP-seq
MIRT2247940	hsa-miR-548i	CLIP-seq
MIRT2247941	hsa-miR-548j	CLIP-seq
MIRT2247942	hsa-miR-548w	CLIP-seq
MIRT2247943	hsa-miR-548y	CLIP-seq
MIRT2247944	hsa-miR-559	CLIP-seq
MIRT2247945	hsa-miR-587	CLIP-seq
MIRT1065475	hsa-miR-598	CLIP-seq
MIRT2247946	hsa-miR-599	CLIP-seq
MIRT2247947	hsa-miR-654-5p	CLIP-seq
MIRT2247948	hsa-miR-885-3p	CLIP-seq
MIRT1065477	hsa-miR-95	CLIP-seq
MIRT2682805	hsa-miR-1207-5p	CLIP-seq
MIRT1065481	hsa-miR-1254	CLIP-seq
MIRT2247885	hsa-miR-1343	CLIP-seq
MIRT1065486	hsa-miR-1470	CLIP-seq
MIRT2682806	hsa-miR-184	CLIP-seq
MIRT1065489	hsa-miR-1908	CLIP-seq
MIRT2682807	hsa-miR-2110	CLIP-seq
MIRT1065497	hsa-miR-2861	CLIP-seq
MIRT1065498	hsa-miR-3116	CLIP-seq
MIRT2682808	hsa-miR-3120-3p	CLIP-seq
MIRT2682809	hsa-miR-3153	CLIP-seq
MIRT1065507	hsa-miR-3180	CLIP-seq
MIRT1065508	hsa-miR-3180-3p	CLIP-seq
MIRT1065511	hsa-miR-3196	CLIP-seq
MIRT1065528	hsa-miR-4254	CLIP-seq
MIRT2682810	hsa-miR-4268	CLIP-seq
MIRT2682811	hsa-miR-4271	CLIP-seq
MIRT1065537	hsa-miR-4469	CLIP-seq
MIRT1065539	hsa-miR-4488	CLIP-seq
MIRT1065542	hsa-miR-4640-5p	CLIP-seq
MIRT1065546	hsa-miR-4667-3p	CLIP-seq
MIRT2682812	hsa-miR-4667-5p	CLIP-seq
MIRT1065553	hsa-miR-4697-5p	CLIP-seq
MIRT2682813	hsa-miR-4700-5p	CLIP-seq
MIRT2682814	hsa-miR-4707-5p	CLIP-seq
MIRT2682815	hsa-miR-4725-3p	CLIP-seq
MIRT1065556	hsa-miR-4726-5p	CLIP-seq
MIRT2682816	hsa-miR-4763-3p	CLIP-seq
MIRT2682817	hsa-miR-4804-5p	CLIP-seq
MIRT1065474	hsa-miR-548an	CLIP-seq
MIRT1065580	hsa-miR-663	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ILF2	Unknown	11739746

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	21123651
GO:0003677	Function	DNA binding	IDA	7519613, 10574923
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	NAS	10400669
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	10574923, 11777942
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IBA
GO:0005515	Function	Protein binding	IPI	9442054, 10574923, 10749851, 11739746, 11777942, 14731398, 17932509, 18337511, 21987769, 22810585, 23853584, 23976881, 24965446, 32296183, 32814053, 35271311, 39251607
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005634	Component	Nucleus	IDA	7519613, 8885239, 10749851, 11739746, 21123651
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10400669
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	21123651
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	21123651
GO:0016020	Component	Membrane	HDA	19946888
GO:0017148	Process	Negative regulation of translation	IEA
GO:0017148	Process	Negative regulation of translation	ISS
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	14731398
GO:0045071	Process	Negative regulation of viral genome replication	IEA
GO:0045071	Process	Negative regulation of viral genome replication	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11739746
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11739746
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0160091	Process	Spliceosome-depend formation of circular RNA	IDA	28625552
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661

MIM	HGNC	e!Ensembl
603182	6038	ENSG00000129351

Q12906

Protein name

Interleukin enhancer-binding factor 3 (Double-stranded RNA-binding protein 76) (DRBP76) (M-phase phosphoprotein 4) (MPP4) (Nuclear factor associated with dsRNA) (NFAR) (Nuclear factor of activated T-cells 90 kDa) (NF-AT-90) (Translational control protein

Protein function

RNA-binding protein that plays an essential role in the biogenesis of circular RNAs (circRNAs) which are produced by back-splicing circularization of pre-mRNAs. Within the nucleus, promotes circRNAs processing by stabilizing the regulatory eleme

PDB

2L33 , 3P1X , 7RJM , 7RJQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07528	DZF	94 → 342	DZF domain	Domain
PF00035	dsrm	402 → 465	Double-stranded RNA binding motif	Domain
PF00035	dsrm	526 → 588	Double-stranded RNA binding motif	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQA
ESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKP
TTALLDKVADNLAIQLAAVTEDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEM
EKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRV
PTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEAT
DAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIP
PSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGE
DSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLK
YELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
KKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRGFGGA
NHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGD
NYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHG
QGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGS
GGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR

Sequence length

894

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HAND	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (61)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	29590119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28839463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29296180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24160375, 26273641, 35579257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27110706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27519414, 37301543, 38072045, 40264052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28839463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29413056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29563539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33885378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	29531354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21347509, 21557786, 25813695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27735951, 31772275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32248186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22912857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31747963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26908601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21347509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35507914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21305022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32404536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	32404536	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33693959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22912857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	25813695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21347509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36050755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	29531354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25544776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	30272251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24160375, 25399696, 27519414, 28487110, 31144362, 31612313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31144362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19088038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24160375, 29296180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29413056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29563539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30906477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31115508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28839463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29413056, 30796096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18039850, 22986534, 28558830		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11167023, 30588088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28935763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33913671	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33794982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	21211798, 21347509, 21468600, 21557786		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30555573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing myopathy	Necrotizing myopathy	BEFREE	11937576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25399696, 29449553, 30588088, 30796096, 31602267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29563539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30906477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	39684939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30423114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31602267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31115508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31115508, 35507914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	26908601	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	26908601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24160375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23208500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ILF3 (interleukin enhancer binding factor 3)