Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3608
Gene name	Interleukin enhancer binding factor 2
Gene symbol	ILF2
Synonyms (NCBI Gene)	NF45PRO3063
Chromosome	1
Chromosome location	1q21.3
Summary	The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa

224

Show/Hide all (224)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022452	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT049906	hsa-miR-31-5p	CLASH	23622248
MIRT049279	hsa-miR-92a-3p	CLASH	23622248
MIRT047288	hsa-miR-181b-5p	CLASH	23622248
MIRT046275	hsa-miR-23b-3p	CLASH	23622248
MIRT045674	hsa-miR-149-5p	CLASH	23622248
MIRT043419	hsa-miR-331-3p	CLASH	23622248
MIRT042209	hsa-miR-484	CLASH	23622248
MIRT040442	hsa-miR-615-3p	CLASH	23622248
MIRT036602	hsa-miR-940	CLASH	23622248
MIRT1065429	hsa-miR-1	CLIP-seq
MIRT1065430	hsa-miR-1270	CLIP-seq
MIRT1065431	hsa-miR-1305	CLIP-seq
MIRT1065432	hsa-miR-1323	CLIP-seq
MIRT1065433	hsa-miR-206	CLIP-seq
MIRT1065434	hsa-miR-3120-3p	CLIP-seq
MIRT1065435	hsa-miR-3130-5p	CLIP-seq
MIRT1065436	hsa-miR-3143	CLIP-seq
MIRT1065437	hsa-miR-3180-5p	CLIP-seq
MIRT1065438	hsa-miR-3673	CLIP-seq
MIRT1065439	hsa-miR-3973	CLIP-seq
MIRT1065440	hsa-miR-421	CLIP-seq
MIRT1065441	hsa-miR-425	CLIP-seq
MIRT1065442	hsa-miR-4282	CLIP-seq
MIRT1065443	hsa-miR-4433	CLIP-seq
MIRT1065444	hsa-miR-4459	CLIP-seq
MIRT1065445	hsa-miR-4482	CLIP-seq
MIRT1065446	hsa-miR-4495	CLIP-seq
MIRT1065447	hsa-miR-4514	CLIP-seq
MIRT1065448	hsa-miR-4531	CLIP-seq
MIRT1065449	hsa-miR-4683	CLIP-seq
MIRT1065450	hsa-miR-4690-5p	CLIP-seq
MIRT1065451	hsa-miR-4692	CLIP-seq
MIRT1065452	hsa-miR-4709-5p	CLIP-seq
MIRT1065453	hsa-miR-4768-3p	CLIP-seq
MIRT1065454	hsa-miR-513a-3p	CLIP-seq
MIRT1065455	hsa-miR-513b	CLIP-seq
MIRT1065456	hsa-miR-520a-5p	CLIP-seq
MIRT1065457	hsa-miR-525-5p	CLIP-seq
MIRT1065458	hsa-miR-543	CLIP-seq
MIRT1065459	hsa-miR-545	CLIP-seq
MIRT1065460	hsa-miR-548l	CLIP-seq
MIRT1065461	hsa-miR-548o	CLIP-seq
MIRT1065462	hsa-miR-571	CLIP-seq
MIRT1065463	hsa-miR-613	CLIP-seq
MIRT1065464	hsa-miR-620	CLIP-seq
MIRT1065465	hsa-miR-654-3p	CLIP-seq
MIRT1065466	hsa-miR-662	CLIP-seq
MIRT1065467	hsa-miR-885-3p	CLIP-seq
MIRT1065429	hsa-miR-1	CLIP-seq
MIRT2015568	hsa-miR-1193	CLIP-seq
MIRT2015569	hsa-miR-1225-5p	CLIP-seq
MIRT1065430	hsa-miR-1270	CLIP-seq
MIRT1065431	hsa-miR-1305	CLIP-seq
MIRT2015570	hsa-miR-136	CLIP-seq
MIRT1065433	hsa-miR-206	CLIP-seq
MIRT2015571	hsa-miR-3074-5p	CLIP-seq
MIRT2015572	hsa-miR-3117-5p	CLIP-seq
MIRT1065434	hsa-miR-3120-3p	CLIP-seq
MIRT2015573	hsa-miR-3132	CLIP-seq
MIRT2015574	hsa-miR-3134	CLIP-seq
MIRT1065436	hsa-miR-3143	CLIP-seq
MIRT2015575	hsa-miR-3179	CLIP-seq
MIRT1065437	hsa-miR-3180-5p	CLIP-seq
MIRT2015576	hsa-miR-3189-3p	CLIP-seq
MIRT1065438	hsa-miR-3673	CLIP-seq
MIRT2015577	hsa-miR-3679-3p	CLIP-seq
MIRT2015578	hsa-miR-370	CLIP-seq
MIRT2015579	hsa-miR-3925-3p	CLIP-seq
MIRT1065439	hsa-miR-3973	CLIP-seq
MIRT2015580	hsa-miR-409-3p	CLIP-seq
MIRT1065440	hsa-miR-421	CLIP-seq
MIRT1065441	hsa-miR-425	CLIP-seq
MIRT1065443	hsa-miR-4433	CLIP-seq
MIRT1065444	hsa-miR-4459	CLIP-seq
MIRT1065446	hsa-miR-4495	CLIP-seq
MIRT2015581	hsa-miR-4496	CLIP-seq
MIRT1065447	hsa-miR-4514	CLIP-seq
MIRT2015582	hsa-miR-4528	CLIP-seq
MIRT1065448	hsa-miR-4531	CLIP-seq
MIRT2015583	hsa-miR-4653-3p	CLIP-seq
MIRT2015584	hsa-miR-4659a-3p	CLIP-seq
MIRT2015585	hsa-miR-4659b-3p	CLIP-seq
MIRT1065449	hsa-miR-4683	CLIP-seq
MIRT1065450	hsa-miR-4690-5p	CLIP-seq
MIRT2015586	hsa-miR-4691-5p	CLIP-seq
MIRT1065451	hsa-miR-4692	CLIP-seq
MIRT1065452	hsa-miR-4709-5p	CLIP-seq
MIRT2015587	hsa-miR-4733-5p	CLIP-seq
MIRT1065453	hsa-miR-4768-3p	CLIP-seq
MIRT2015588	hsa-miR-4781-3p	CLIP-seq
MIRT2015589	hsa-miR-4802-5p	CLIP-seq
MIRT1065455	hsa-miR-513b	CLIP-seq
MIRT1065456	hsa-miR-520a-5p	CLIP-seq
MIRT1065457	hsa-miR-525-5p	CLIP-seq
MIRT1065458	hsa-miR-543	CLIP-seq
MIRT1065459	hsa-miR-545	CLIP-seq
MIRT1065460	hsa-miR-548l	CLIP-seq
MIRT1065462	hsa-miR-571	CLIP-seq
MIRT1065463	hsa-miR-613	CLIP-seq
MIRT1065464	hsa-miR-620	CLIP-seq
MIRT1065465	hsa-miR-654-3p	CLIP-seq
MIRT1065466	hsa-miR-662	CLIP-seq
MIRT1065467	hsa-miR-885-3p	CLIP-seq
MIRT2015590	hsa-miR-885-5p	CLIP-seq
MIRT1065429	hsa-miR-1	CLIP-seq
MIRT2015568	hsa-miR-1193	CLIP-seq
MIRT1065430	hsa-miR-1270	CLIP-seq
MIRT1065431	hsa-miR-1305	CLIP-seq
MIRT1065432	hsa-miR-1323	CLIP-seq
MIRT2015570	hsa-miR-136	CLIP-seq
MIRT1065433	hsa-miR-206	CLIP-seq
MIRT2015571	hsa-miR-3074-5p	CLIP-seq
MIRT2015572	hsa-miR-3117-5p	CLIP-seq
MIRT1065434	hsa-miR-3120-3p	CLIP-seq
MIRT1065435	hsa-miR-3130-5p	CLIP-seq
MIRT2015574	hsa-miR-3134	CLIP-seq
MIRT1065436	hsa-miR-3143	CLIP-seq
MIRT1065437	hsa-miR-3180-5p	CLIP-seq
MIRT1065438	hsa-miR-3673	CLIP-seq
MIRT2015578	hsa-miR-370	CLIP-seq
MIRT2015579	hsa-miR-3925-3p	CLIP-seq
MIRT1065439	hsa-miR-3973	CLIP-seq
MIRT1065440	hsa-miR-421	CLIP-seq
MIRT1065441	hsa-miR-425	CLIP-seq
MIRT1065443	hsa-miR-4433	CLIP-seq
MIRT1065444	hsa-miR-4459	CLIP-seq
MIRT2247879	hsa-miR-4463	CLIP-seq
MIRT1065445	hsa-miR-4482	CLIP-seq
MIRT1065446	hsa-miR-4495	CLIP-seq
MIRT1065447	hsa-miR-4514	CLIP-seq
MIRT2015582	hsa-miR-4528	CLIP-seq
MIRT1065448	hsa-miR-4531	CLIP-seq
MIRT2015583	hsa-miR-4653-3p	CLIP-seq
MIRT2015584	hsa-miR-4659a-3p	CLIP-seq
MIRT2015585	hsa-miR-4659b-3p	CLIP-seq
MIRT1065449	hsa-miR-4683	CLIP-seq
MIRT1065450	hsa-miR-4690-5p	CLIP-seq
MIRT2015586	hsa-miR-4691-5p	CLIP-seq
MIRT1065451	hsa-miR-4692	CLIP-seq
MIRT1065452	hsa-miR-4709-5p	CLIP-seq
MIRT2247880	hsa-miR-4719	CLIP-seq
MIRT2015587	hsa-miR-4733-5p	CLIP-seq
MIRT1065453	hsa-miR-4768-3p	CLIP-seq
MIRT2015589	hsa-miR-4802-5p	CLIP-seq
MIRT1065455	hsa-miR-513b	CLIP-seq
MIRT1065456	hsa-miR-520a-5p	CLIP-seq
MIRT1065457	hsa-miR-525-5p	CLIP-seq
MIRT1065458	hsa-miR-543	CLIP-seq
MIRT1065459	hsa-miR-545	CLIP-seq
MIRT1065460	hsa-miR-548l	CLIP-seq
MIRT1065461	hsa-miR-548o	CLIP-seq
MIRT1065462	hsa-miR-571	CLIP-seq
MIRT1065463	hsa-miR-613	CLIP-seq
MIRT1065464	hsa-miR-620	CLIP-seq
MIRT1065467	hsa-miR-885-3p	CLIP-seq
MIRT2015590	hsa-miR-885-5p	CLIP-seq
MIRT1065443	hsa-miR-4433	CLIP-seq
MIRT1065444	hsa-miR-4459	CLIP-seq
MIRT1065446	hsa-miR-4495	CLIP-seq
MIRT1065450	hsa-miR-4690-5p	CLIP-seq
MIRT1065453	hsa-miR-4768-3p	CLIP-seq
MIRT1065429	hsa-miR-1	CLIP-seq
MIRT2015569	hsa-miR-1225-5p	CLIP-seq
MIRT1065432	hsa-miR-1323	CLIP-seq
MIRT1065433	hsa-miR-206	CLIP-seq
MIRT2015571	hsa-miR-3074-5p	CLIP-seq
MIRT2015572	hsa-miR-3117-5p	CLIP-seq
MIRT1065435	hsa-miR-3130-5p	CLIP-seq
MIRT2015573	hsa-miR-3132	CLIP-seq
MIRT2015575	hsa-miR-3179	CLIP-seq
MIRT2015576	hsa-miR-3189-3p	CLIP-seq
MIRT1065438	hsa-miR-3673	CLIP-seq
MIRT2015577	hsa-miR-3679-3p	CLIP-seq
MIRT2015578	hsa-miR-370	CLIP-seq
MIRT2015579	hsa-miR-3925-3p	CLIP-seq
MIRT1065441	hsa-miR-425	CLIP-seq
MIRT1065445	hsa-miR-4482	CLIP-seq
MIRT1065446	hsa-miR-4495	CLIP-seq
MIRT2015581	hsa-miR-4496	CLIP-seq
MIRT1065447	hsa-miR-4514	CLIP-seq
MIRT2015583	hsa-miR-4653-3p	CLIP-seq
MIRT2015584	hsa-miR-4659a-3p	CLIP-seq
MIRT2015585	hsa-miR-4659b-3p	CLIP-seq
MIRT1065450	hsa-miR-4690-5p	CLIP-seq
MIRT1065451	hsa-miR-4692	CLIP-seq
MIRT2015587	hsa-miR-4733-5p	CLIP-seq
MIRT2015589	hsa-miR-4802-5p	CLIP-seq
MIRT1065461	hsa-miR-548o	CLIP-seq
MIRT1065463	hsa-miR-613	CLIP-seq
MIRT1065465	hsa-miR-654-3p	CLIP-seq
MIRT1065466	hsa-miR-662	CLIP-seq
MIRT1065467	hsa-miR-885-3p	CLIP-seq
MIRT1065429	hsa-miR-1	CLIP-seq
MIRT2015569	hsa-miR-1225-5p	CLIP-seq
MIRT1065432	hsa-miR-1323	CLIP-seq
MIRT1065433	hsa-miR-206	CLIP-seq
MIRT2015571	hsa-miR-3074-5p	CLIP-seq
MIRT2015572	hsa-miR-3117-5p	CLIP-seq
MIRT1065435	hsa-miR-3130-5p	CLIP-seq
MIRT2015573	hsa-miR-3132	CLIP-seq
MIRT2015575	hsa-miR-3179	CLIP-seq
MIRT2015576	hsa-miR-3189-3p	CLIP-seq
MIRT1065438	hsa-miR-3673	CLIP-seq
MIRT2015577	hsa-miR-3679-3p	CLIP-seq
MIRT2015578	hsa-miR-370	CLIP-seq
MIRT2015579	hsa-miR-3925-3p	CLIP-seq
MIRT1065441	hsa-miR-425	CLIP-seq
MIRT1065445	hsa-miR-4482	CLIP-seq
MIRT1065446	hsa-miR-4495	CLIP-seq
MIRT2015581	hsa-miR-4496	CLIP-seq
MIRT1065447	hsa-miR-4514	CLIP-seq
MIRT2015583	hsa-miR-4653-3p	CLIP-seq
MIRT2015584	hsa-miR-4659a-3p	CLIP-seq
MIRT2015585	hsa-miR-4659b-3p	CLIP-seq
MIRT1065450	hsa-miR-4690-5p	CLIP-seq
MIRT1065451	hsa-miR-4692	CLIP-seq
MIRT2015587	hsa-miR-4733-5p	CLIP-seq
MIRT2015589	hsa-miR-4802-5p	CLIP-seq
MIRT1065461	hsa-miR-548o	CLIP-seq
MIRT1065463	hsa-miR-613	CLIP-seq
MIRT1065465	hsa-miR-654-3p	CLIP-seq
MIRT1065466	hsa-miR-662	CLIP-seq
MIRT1065467	hsa-miR-885-3p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IDA	7519613, 10574923, 11804788
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	10574923
GO:0005515	Function	Protein binding	IPI	9442054, 10574923, 11739746, 17289661, 21146485, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	7519613, 21123651
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	11790298
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0035580	Component	Specific granule lumen	TAS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11739746
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661

MIM	HGNC	e!Ensembl
603181	6037	ENSG00000143621

Q12905

Protein name

Interleukin enhancer-binding factor 2 (Nuclear factor of activated T-cells 45 kDa)

Protein function

Chromatin-interacting protein that forms a stable heterodimer with interleukin enhancer-binding factor 3/ILF3 and plays a role in several biological processes including transcription, innate immunity or cell growth (PubMed:18458058, PubMed:31212

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07528	DZF	104 → 338	DZF domain	Domain

Sequence

MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKR
NQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVA
DLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTV
PPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPL
TPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT
VMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEK
PPEKKEGEEEEENTEEPPQGEEEESMETQE

Sequence length

390

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26276310		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27556459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30018709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37298108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25023405, 25286760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27519414, 30881868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	31423236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23208500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32116234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23799036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25286760, 36717549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25023405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31423236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIB	Glycogen storage disease	Pubtator	34709752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27519414, 27556459, 31612313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31619507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28831206	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30018709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27556459, 30881868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28831206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30018709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34709752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28669490		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	28669490, 35145187	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30555573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25286760, 26059795, 26276310, 31423236		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27153397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26059795, 31423236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28259961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26276310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28259961	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	23208500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37047232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25286760, 30550728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35333683, 37864310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28831206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28831206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38238853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23208500, 39968981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ILF2 (interleukin enhancer binding factor 2)