Gene Gene information from NCBI Gene database.
Entrez ID 3606
Gene name Interleukin 18
Gene symbol IL18
Synonyms (NCBI Gene)
IGIFIL-18IL-1gIL1F4
Chromosome 11
Chromosome location 11q23.1
Summary The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to
miRNA miRNA information provided by mirtarbase database.
41
miRTarBase ID miRNA Experiments Reference
MIRT004304 hsa-miR-346 qRT-PCRLuciferase reporter assayWestern blotNorthern blot 19342689
MIRT054556 hsa-miR-197-3p MicroarrayqRT-PCR 23710316
MIRT438748 hsa-miR-130a-3p ELISALuciferase reporter assayqRT-PCR 24801815
MIRT438748 hsa-miR-130a-3p ELISALuciferase reporter assayqRT-PCR 24801815
MIRT1064132 hsa-miR-129-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Transcription factor Regulation Reference
HDAC9 Unknown 11944905
NFKB1 Activation 15963597;17399992
NFKB1 Unknown 10227974
RELA Activation 15963597;17399992
RELA Unknown 10227974
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
76
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IDA 11466388
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IDA 14528293, 25500532
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600953 5986 ENSG00000150782
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14116
Protein name Interleukin-18 (IL-18) (Iboctadekin) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
Protein function Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses (PubMed:10653850). Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex whi
PDB 1J0S , 2VXT , 3F62 , 3WO2 , 3WO3 , 3WO4 , 4EEE , 4EKX , 4HJJ , 4R6U , 4XFS , 4XFT , 4XFU , 7AL7 , 8J6K , 8SPB , 8SV1 , 8URV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00340 IL1 72 185 Interleukin-1 / 18 Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 2]: Expressed in ovarian carcinoma but undetectable in normal ovarian epithelial cells. Resistant to proteolytic activation by caspase-1 and -4. {ECO:0000269|PubMed:15326478}.
Sequence
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSI
MFTVQNED
Sequence length 193
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Legionellosis
Yersinia infection
African trypanosomiasis
Malaria
Tuberculosis
Influenza A
Inflammatory bowel disease
Rheumatoid arthritis
Lipid and atherosclerosis
  Interleukin-1 processing
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Interleukin-18 signaling
Purinergic signaling in leishmaniasis infection
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
42
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ARTHRITIS, RHEUMATOID CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
AA amyloidosis AA amyloidosis BEFREE 15257727
★☆☆☆☆
Found in Text Mining only
Acne Acne BEFREE 12554798
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 25747584, 28456882, 28689006, 29685010, 31596518
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 24778454
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 30217873, 30997931, 31764513
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 12163048, 26342105, 27928589
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 27706625
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 28630305
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 10371355, 28811967
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Of Esophagus Esophageal Cancer BEFREE 22664470, 22951876
★☆☆☆☆
Found in Text Mining only