Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3604
Gene name	TNF receptor superfamily member 9
Gene symbol	TNFRSF9
Synonyms (NCBI Gene)	4-1BBCD137CDw137ILAIMD109
Chromosome	1
Chromosome location	1p36.23
Summary	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induc

659

Show/Hide all (659)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017048	hsa-miR-335-5p	Microarray	18185580
MIRT027444	hsa-miR-98-5p	Microarray	19088304
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	19536157
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT613859	hsa-miR-4267	HITS-CLIP	19536157
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	19536157
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT645227	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT645226	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT645225	hsa-miR-3671	HITS-CLIP	23824327
MIRT645224	hsa-miR-607	HITS-CLIP	23824327
MIRT645223	hsa-miR-1305	HITS-CLIP	23824327
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515866	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT515865	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT515866	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT515865	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	27418678
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	27418678
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	27418678
MIRT613859	hsa-miR-4267	HITS-CLIP	27418678
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	27418678
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	19536157
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT613859	hsa-miR-4267	HITS-CLIP	19536157
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	19536157
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT645227	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT645226	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT645225	hsa-miR-3671	HITS-CLIP	23824327
MIRT645224	hsa-miR-607	HITS-CLIP	23824327
MIRT645223	hsa-miR-1305	HITS-CLIP	23824327
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT613861	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT613860	hsa-miR-4733-3p	HITS-CLIP	23824327
MIRT613859	hsa-miR-4267	HITS-CLIP	23824327
MIRT613858	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT613857	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515866	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT515865	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT515866	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT515865	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508992	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508991	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508990	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1443167	hsa-miR-105	CLIP-seq
MIRT1443168	hsa-miR-10a	CLIP-seq
MIRT1443169	hsa-miR-10b	CLIP-seq
MIRT1443170	hsa-miR-1207-5p	CLIP-seq
MIRT1443171	hsa-miR-1208	CLIP-seq
MIRT1443172	hsa-miR-122	CLIP-seq
MIRT1443173	hsa-miR-1224-3p	CLIP-seq
MIRT1443174	hsa-miR-1225-3p	CLIP-seq
MIRT1443175	hsa-miR-1226	CLIP-seq
MIRT1443176	hsa-miR-1227	CLIP-seq
MIRT1443177	hsa-miR-1229	CLIP-seq
MIRT1443178	hsa-miR-1233	CLIP-seq
MIRT1443179	hsa-miR-1234	CLIP-seq
MIRT1443180	hsa-miR-1254	CLIP-seq
MIRT1443181	hsa-miR-1262	CLIP-seq
MIRT1443182	hsa-miR-1273f	CLIP-seq
MIRT1443183	hsa-miR-1285	CLIP-seq
MIRT1443184	hsa-miR-130a	CLIP-seq
MIRT1443185	hsa-miR-130b	CLIP-seq
MIRT1443186	hsa-miR-1343	CLIP-seq
MIRT1443187	hsa-miR-150	CLIP-seq
MIRT1443188	hsa-miR-1827	CLIP-seq
MIRT1443189	hsa-miR-183	CLIP-seq
MIRT1443190	hsa-miR-1912	CLIP-seq
MIRT1443191	hsa-miR-1913	CLIP-seq
MIRT1443192	hsa-miR-203	CLIP-seq
MIRT1443193	hsa-miR-2467-3p	CLIP-seq
MIRT1443194	hsa-miR-2682	CLIP-seq
MIRT1443195	hsa-miR-301a	CLIP-seq
MIRT1443196	hsa-miR-301b	CLIP-seq
MIRT1443197	hsa-miR-3064-3p	CLIP-seq
MIRT1443198	hsa-miR-3116	CLIP-seq
MIRT1443199	hsa-miR-3119	CLIP-seq
MIRT1443200	hsa-miR-3122	CLIP-seq
MIRT1443201	hsa-miR-3130-5p	CLIP-seq
MIRT1443202	hsa-miR-3145-5p	CLIP-seq
MIRT1443203	hsa-miR-3163	CLIP-seq
MIRT1443204	hsa-miR-3165	CLIP-seq
MIRT1443205	hsa-miR-3170	CLIP-seq
MIRT1443206	hsa-miR-3182	CLIP-seq
MIRT1443207	hsa-miR-3187-3p	CLIP-seq
MIRT1443208	hsa-miR-3187-5p	CLIP-seq
MIRT1443209	hsa-miR-3192	CLIP-seq
MIRT1443210	hsa-miR-3197	CLIP-seq
MIRT1443211	hsa-miR-3202	CLIP-seq
MIRT1443212	hsa-miR-323-5p	CLIP-seq
MIRT1443213	hsa-miR-324-3p	CLIP-seq
MIRT1443214	hsa-miR-339-5p	CLIP-seq
MIRT1443215	hsa-miR-3612	CLIP-seq
MIRT1443216	hsa-miR-3614-5p	CLIP-seq
MIRT1443217	hsa-miR-3622a-3p	CLIP-seq
MIRT1443218	hsa-miR-3622b-3p	CLIP-seq
MIRT1443219	hsa-miR-3656	CLIP-seq
MIRT1443220	hsa-miR-3664-3p	CLIP-seq
MIRT1443221	hsa-miR-3666	CLIP-seq
MIRT1443222	hsa-miR-3667-5p	CLIP-seq
MIRT1443223	hsa-miR-3670	CLIP-seq
MIRT1443224	hsa-miR-3672	CLIP-seq
MIRT1443225	hsa-miR-3689a-3p	CLIP-seq
MIRT1443226	hsa-miR-3689c	CLIP-seq
MIRT1443227	hsa-miR-3690	CLIP-seq
MIRT1443228	hsa-miR-378g	CLIP-seq
MIRT1443229	hsa-miR-3913-5p	CLIP-seq
MIRT1443230	hsa-miR-3929	CLIP-seq
MIRT1443231	hsa-miR-411	CLIP-seq
MIRT1443232	hsa-miR-4252	CLIP-seq
MIRT1443233	hsa-miR-4257	CLIP-seq
MIRT1443234	hsa-miR-4258	CLIP-seq
MIRT1443235	hsa-miR-4266	CLIP-seq
MIRT1443236	hsa-miR-4269	CLIP-seq
MIRT1443237	hsa-miR-4270	CLIP-seq
MIRT1443238	hsa-miR-4295	CLIP-seq
MIRT1443239	hsa-miR-4419b	CLIP-seq
MIRT1443240	hsa-miR-4420	CLIP-seq
MIRT1443241	hsa-miR-4433	CLIP-seq
MIRT1443242	hsa-miR-4435	CLIP-seq
MIRT1443243	hsa-miR-4437	CLIP-seq
MIRT1443244	hsa-miR-4438	CLIP-seq
MIRT1443245	hsa-miR-4441	CLIP-seq
MIRT1443246	hsa-miR-4459	CLIP-seq
MIRT1443247	hsa-miR-4467	CLIP-seq
MIRT1443248	hsa-miR-4478	CLIP-seq
MIRT1443249	hsa-miR-4482	CLIP-seq
MIRT1443250	hsa-miR-4499	CLIP-seq
MIRT1443251	hsa-miR-449c	CLIP-seq
MIRT1443252	hsa-miR-4529-5p	CLIP-seq
MIRT1443253	hsa-miR-4533	CLIP-seq
MIRT1443254	hsa-miR-454	CLIP-seq
MIRT1443255	hsa-miR-4638-3p	CLIP-seq
MIRT1443256	hsa-miR-4649-3p	CLIP-seq
MIRT1443257	hsa-miR-4659a-3p	CLIP-seq
MIRT1443258	hsa-miR-4659b-3p	CLIP-seq
MIRT1443259	hsa-miR-4674	CLIP-seq
MIRT1443260	hsa-miR-4683	CLIP-seq
MIRT1443261	hsa-miR-4695-5p	CLIP-seq
MIRT1443262	hsa-miR-4701-3p	CLIP-seq
MIRT1443263	hsa-miR-4701-5p	CLIP-seq
MIRT1443264	hsa-miR-4715-3p	CLIP-seq
MIRT1443265	hsa-miR-4725-5p	CLIP-seq
MIRT1443266	hsa-miR-4727-5p	CLIP-seq
MIRT1443267	hsa-miR-4728-5p	CLIP-seq
MIRT1443268	hsa-miR-4729	CLIP-seq
MIRT1443269	hsa-miR-4730	CLIP-seq
MIRT1443270	hsa-miR-4738-3p	CLIP-seq
MIRT1443271	hsa-miR-4755-3p	CLIP-seq
MIRT1443272	hsa-miR-4763-3p	CLIP-seq
MIRT1443273	hsa-miR-4768-3p	CLIP-seq
MIRT1443274	hsa-miR-4769-3p	CLIP-seq
MIRT1443275	hsa-miR-4772-3p	CLIP-seq
MIRT1443276	hsa-miR-4773	CLIP-seq
MIRT1443277	hsa-miR-4779	CLIP-seq
MIRT1443278	hsa-miR-4786-5p	CLIP-seq
MIRT1443279	hsa-miR-4793-3p	CLIP-seq
MIRT1443280	hsa-miR-4797-5p	CLIP-seq
MIRT1443281	hsa-miR-4803	CLIP-seq
MIRT1443282	hsa-miR-485-5p	CLIP-seq
MIRT1443283	hsa-miR-498	CLIP-seq
MIRT1443284	hsa-miR-504	CLIP-seq
MIRT1443285	hsa-miR-508-3p	CLIP-seq
MIRT1443286	hsa-miR-508-5p	CLIP-seq
MIRT1443287	hsa-miR-5095	CLIP-seq
MIRT1443288	hsa-miR-520g	CLIP-seq
MIRT1443289	hsa-miR-520h	CLIP-seq
MIRT1443290	hsa-miR-541	CLIP-seq
MIRT1443291	hsa-miR-542-3p	CLIP-seq
MIRT1443292	hsa-miR-544b	CLIP-seq
MIRT1443293	hsa-miR-548s	CLIP-seq
MIRT1443294	hsa-miR-579	CLIP-seq
MIRT1443295	hsa-miR-588	CLIP-seq
MIRT1443296	hsa-miR-612	CLIP-seq
MIRT1443297	hsa-miR-639	CLIP-seq
MIRT1443298	hsa-miR-650	CLIP-seq
MIRT1443299	hsa-miR-654-5p	CLIP-seq
MIRT1443300	hsa-miR-661	CLIP-seq
MIRT1443301	hsa-miR-665	CLIP-seq
MIRT1443302	hsa-miR-720	CLIP-seq
MIRT1443303	hsa-miR-759	CLIP-seq
MIRT1443304	hsa-miR-766	CLIP-seq
MIRT1443305	hsa-miR-769-5p	CLIP-seq
MIRT1443306	hsa-miR-876-3p	CLIP-seq
MIRT1443307	hsa-miR-890	CLIP-seq
MIRT1443308	hsa-miR-892a	CLIP-seq
MIRT1443309	hsa-miR-9	CLIP-seq
MIRT1443310	hsa-miR-940	CLIP-seq
MIRT1443179	hsa-miR-1234	CLIP-seq
MIRT1443187	hsa-miR-150	CLIP-seq
MIRT1443216	hsa-miR-3614-5p	CLIP-seq
MIRT1443220	hsa-miR-3664-3p	CLIP-seq
MIRT1443241	hsa-miR-4433	CLIP-seq
MIRT1443246	hsa-miR-4459	CLIP-seq
MIRT1443273	hsa-miR-4768-3p	CLIP-seq
MIRT1443288	hsa-miR-520g	CLIP-seq
MIRT1443289	hsa-miR-520h	CLIP-seq
MIRT1443175	hsa-miR-1226	CLIP-seq
MIRT1443175	hsa-miR-1226	CLIP-seq
MIRT1443175	hsa-miR-1226	CLIP-seq
MIRT1443175	hsa-miR-1226	CLIP-seq
MIRT1443172	hsa-miR-122	CLIP-seq
MIRT1443175	hsa-miR-1226	CLIP-seq
MIRT1443176	hsa-miR-1227	CLIP-seq
MIRT1443179	hsa-miR-1234	CLIP-seq
MIRT2132645	hsa-miR-1257	CLIP-seq
MIRT1443181	hsa-miR-1262	CLIP-seq
MIRT1443183	hsa-miR-1285	CLIP-seq
MIRT2132646	hsa-miR-1307	CLIP-seq
MIRT1443184	hsa-miR-130a	CLIP-seq
MIRT1443185	hsa-miR-130b	CLIP-seq
MIRT1443186	hsa-miR-1343	CLIP-seq
MIRT2132647	hsa-miR-136	CLIP-seq
MIRT1443187	hsa-miR-150	CLIP-seq
MIRT1443188	hsa-miR-1827	CLIP-seq
MIRT1443189	hsa-miR-183	CLIP-seq
MIRT1443192	hsa-miR-203	CLIP-seq
MIRT2132648	hsa-miR-2114	CLIP-seq
MIRT1443193	hsa-miR-2467-3p	CLIP-seq
MIRT1443195	hsa-miR-301a	CLIP-seq
MIRT1443196	hsa-miR-301b	CLIP-seq
MIRT1443200	hsa-miR-3122	CLIP-seq
MIRT2132649	hsa-miR-3130-3p	CLIP-seq
MIRT1443201	hsa-miR-3130-5p	CLIP-seq
MIRT2132650	hsa-miR-3149	CLIP-seq
MIRT1443204	hsa-miR-3165	CLIP-seq
MIRT1443205	hsa-miR-3170	CLIP-seq
MIRT1443206	hsa-miR-3182	CLIP-seq
MIRT1443208	hsa-miR-3187-5p	CLIP-seq
MIRT1443210	hsa-miR-3197	CLIP-seq
MIRT1443212	hsa-miR-323-5p	CLIP-seq
MIRT1443215	hsa-miR-3612	CLIP-seq
MIRT1443216	hsa-miR-3614-5p	CLIP-seq
MIRT1443217	hsa-miR-3622a-3p	CLIP-seq
MIRT1443218	hsa-miR-3622b-3p	CLIP-seq
MIRT1443219	hsa-miR-3656	CLIP-seq
MIRT1443220	hsa-miR-3664-3p	CLIP-seq
MIRT1443221	hsa-miR-3666	CLIP-seq
MIRT1443223	hsa-miR-3670	CLIP-seq
MIRT1443224	hsa-miR-3672	CLIP-seq
MIRT1443225	hsa-miR-3689a-3p	CLIP-seq
MIRT1443226	hsa-miR-3689c	CLIP-seq
MIRT1443229	hsa-miR-3913-5p	CLIP-seq
MIRT1443230	hsa-miR-3929	CLIP-seq
MIRT1443232	hsa-miR-4252	CLIP-seq
MIRT1443233	hsa-miR-4257	CLIP-seq
MIRT1443235	hsa-miR-4266	CLIP-seq
MIRT2132651	hsa-miR-4284	CLIP-seq
MIRT1443238	hsa-miR-4295	CLIP-seq
MIRT1443239	hsa-miR-4419b	CLIP-seq
MIRT1443241	hsa-miR-4433	CLIP-seq
MIRT1443244	hsa-miR-4438	CLIP-seq
MIRT1443246	hsa-miR-4459	CLIP-seq
MIRT1443248	hsa-miR-4478	CLIP-seq
MIRT2132652	hsa-miR-4480	CLIP-seq
MIRT1443249	hsa-miR-4482	CLIP-seq
MIRT1443250	hsa-miR-4499	CLIP-seq
MIRT1443254	hsa-miR-454	CLIP-seq
MIRT2132653	hsa-miR-4638-5p	CLIP-seq
MIRT1443256	hsa-miR-4649-3p	CLIP-seq
MIRT1443257	hsa-miR-4659a-3p	CLIP-seq
MIRT1443258	hsa-miR-4659b-3p	CLIP-seq
MIRT1443261	hsa-miR-4695-5p	CLIP-seq
MIRT1443262	hsa-miR-4701-3p	CLIP-seq
MIRT1443264	hsa-miR-4715-3p	CLIP-seq
MIRT2132654	hsa-miR-4716-5p	CLIP-seq
MIRT1443266	hsa-miR-4727-5p	CLIP-seq
MIRT1443267	hsa-miR-4728-5p	CLIP-seq
MIRT2132655	hsa-miR-4735-5p	CLIP-seq
MIRT1443273	hsa-miR-4768-3p	CLIP-seq
MIRT1443274	hsa-miR-4769-3p	CLIP-seq
MIRT1443275	hsa-miR-4772-3p	CLIP-seq
MIRT2132656	hsa-miR-4775	CLIP-seq
MIRT1443277	hsa-miR-4779	CLIP-seq
MIRT1443278	hsa-miR-4786-5p	CLIP-seq
MIRT1443279	hsa-miR-4793-3p	CLIP-seq
MIRT1443281	hsa-miR-4803	CLIP-seq
MIRT1443283	hsa-miR-498	CLIP-seq
MIRT1443286	hsa-miR-508-5p	CLIP-seq
MIRT1443287	hsa-miR-5095	CLIP-seq
MIRT2132657	hsa-miR-516b	CLIP-seq
MIRT1443288	hsa-miR-520g	CLIP-seq
MIRT1443289	hsa-miR-520h	CLIP-seq
MIRT1443290	hsa-miR-541	CLIP-seq
MIRT1443291	hsa-miR-542-3p	CLIP-seq
MIRT1443292	hsa-miR-544b	CLIP-seq
MIRT2132658	hsa-miR-590-3p	CLIP-seq
MIRT1443296	hsa-miR-612	CLIP-seq
MIRT2132659	hsa-miR-622	CLIP-seq
MIRT1443297	hsa-miR-639	CLIP-seq
MIRT1443298	hsa-miR-650	CLIP-seq
MIRT1443299	hsa-miR-654-5p	CLIP-seq
MIRT1443300	hsa-miR-661	CLIP-seq
MIRT1443302	hsa-miR-720	CLIP-seq
MIRT1443304	hsa-miR-766	CLIP-seq
MIRT1443305	hsa-miR-769-5p	CLIP-seq
MIRT1443306	hsa-miR-876-3p	CLIP-seq
MIRT1443307	hsa-miR-890	CLIP-seq
MIRT2132660	hsa-miR-941	CLIP-seq
MIRT1443172	hsa-miR-122	CLIP-seq
MIRT1443180	hsa-miR-1254	CLIP-seq
MIRT2353648	hsa-miR-125a-3p	CLIP-seq
MIRT1443181	hsa-miR-1262	CLIP-seq
MIRT1443183	hsa-miR-1285	CLIP-seq
MIRT2132646	hsa-miR-1307	CLIP-seq
MIRT1443184	hsa-miR-130a	CLIP-seq
MIRT1443185	hsa-miR-130b	CLIP-seq
MIRT2353649	hsa-miR-1323	CLIP-seq
MIRT1443186	hsa-miR-1343	CLIP-seq
MIRT1443187	hsa-miR-150	CLIP-seq
MIRT1443188	hsa-miR-1827	CLIP-seq
MIRT1443189	hsa-miR-183	CLIP-seq
MIRT2353650	hsa-miR-1915	CLIP-seq
MIRT2353651	hsa-miR-24	CLIP-seq
MIRT1443193	hsa-miR-2467-3p	CLIP-seq
MIRT2353652	hsa-miR-27a	CLIP-seq
MIRT2353653	hsa-miR-27b	CLIP-seq
MIRT1443195	hsa-miR-301a	CLIP-seq
MIRT1443196	hsa-miR-301b	CLIP-seq
MIRT1443198	hsa-miR-3116	CLIP-seq
MIRT1443200	hsa-miR-3122	CLIP-seq
MIRT2132649	hsa-miR-3130-3p	CLIP-seq
MIRT1443201	hsa-miR-3130-5p	CLIP-seq
MIRT2353654	hsa-miR-3135b	CLIP-seq
MIRT1443202	hsa-miR-3145-5p	CLIP-seq
MIRT2353655	hsa-miR-3155	CLIP-seq
MIRT2353656	hsa-miR-3155b	CLIP-seq
MIRT1443204	hsa-miR-3165	CLIP-seq
MIRT1443208	hsa-miR-3187-5p	CLIP-seq
MIRT1443209	hsa-miR-3192	CLIP-seq
MIRT1443210	hsa-miR-3197	CLIP-seq
MIRT1443211	hsa-miR-3202	CLIP-seq
MIRT2353657	hsa-miR-330-3p	CLIP-seq
MIRT2353658	hsa-miR-3607-3p	CLIP-seq
MIRT2353659	hsa-miR-3609	CLIP-seq
MIRT1443215	hsa-miR-3612	CLIP-seq
MIRT1443216	hsa-miR-3614-5p	CLIP-seq
MIRT1443217	hsa-miR-3622a-3p	CLIP-seq
MIRT1443218	hsa-miR-3622b-3p	CLIP-seq
MIRT2353660	hsa-miR-3622b-5p	CLIP-seq
MIRT2353661	hsa-miR-3652	CLIP-seq
MIRT1443219	hsa-miR-3656	CLIP-seq
MIRT1443220	hsa-miR-3664-3p	CLIP-seq
MIRT1443221	hsa-miR-3666	CLIP-seq
MIRT1443223	hsa-miR-3670	CLIP-seq
MIRT1443224	hsa-miR-3672	CLIP-seq
MIRT2353662	hsa-miR-3686	CLIP-seq
MIRT1443225	hsa-miR-3689a-3p	CLIP-seq
MIRT1443226	hsa-miR-3689c	CLIP-seq
MIRT1443229	hsa-miR-3913-5p	CLIP-seq
MIRT2353663	hsa-miR-3926	CLIP-seq
MIRT1443230	hsa-miR-3929	CLIP-seq
MIRT2353664	hsa-miR-3934	CLIP-seq
MIRT2353665	hsa-miR-410	CLIP-seq
MIRT1443232	hsa-miR-4252	CLIP-seq
MIRT1443233	hsa-miR-4257	CLIP-seq
MIRT1443236	hsa-miR-4269	CLIP-seq
MIRT2132651	hsa-miR-4284	CLIP-seq
MIRT1443238	hsa-miR-4295	CLIP-seq
MIRT1443239	hsa-miR-4419b	CLIP-seq
MIRT2353666	hsa-miR-4430	CLIP-seq
MIRT1443241	hsa-miR-4433	CLIP-seq
MIRT1443242	hsa-miR-4435	CLIP-seq
MIRT1443244	hsa-miR-4438	CLIP-seq
MIRT1443246	hsa-miR-4459	CLIP-seq
MIRT1443248	hsa-miR-4478	CLIP-seq
MIRT1443249	hsa-miR-4482	CLIP-seq
MIRT1443250	hsa-miR-4499	CLIP-seq
MIRT1443253	hsa-miR-4533	CLIP-seq
MIRT1443254	hsa-miR-454	CLIP-seq
MIRT2132653	hsa-miR-4638-5p	CLIP-seq
MIRT1443256	hsa-miR-4649-3p	CLIP-seq
MIRT1443262	hsa-miR-4701-3p	CLIP-seq
MIRT1443263	hsa-miR-4701-5p	CLIP-seq
MIRT2353667	hsa-miR-4703-3p	CLIP-seq
MIRT1443264	hsa-miR-4715-3p	CLIP-seq
MIRT2353668	hsa-miR-4722-5p	CLIP-seq
MIRT2353669	hsa-miR-4726-3p	CLIP-seq
MIRT1443267	hsa-miR-4728-5p	CLIP-seq
MIRT1443268	hsa-miR-4729	CLIP-seq
MIRT2132655	hsa-miR-4735-5p	CLIP-seq
MIRT1443271	hsa-miR-4755-3p	CLIP-seq
MIRT1443273	hsa-miR-4768-3p	CLIP-seq
MIRT1443275	hsa-miR-4772-3p	CLIP-seq
MIRT2132656	hsa-miR-4775	CLIP-seq
MIRT1443278	hsa-miR-4786-5p	CLIP-seq
MIRT1443280	hsa-miR-4797-5p	CLIP-seq
MIRT1443281	hsa-miR-4803	CLIP-seq
MIRT2353670	hsa-miR-484	CLIP-seq
MIRT1443283	hsa-miR-498	CLIP-seq
MIRT2353671	hsa-miR-507	CLIP-seq
MIRT1443286	hsa-miR-508-5p	CLIP-seq
MIRT1443287	hsa-miR-5095	CLIP-seq
MIRT2353672	hsa-miR-510	CLIP-seq
MIRT2353673	hsa-miR-512-5p	CLIP-seq
MIRT2132657	hsa-miR-516b	CLIP-seq
MIRT1443288	hsa-miR-520g	CLIP-seq
MIRT1443289	hsa-miR-520h	CLIP-seq
MIRT1443290	hsa-miR-541	CLIP-seq
MIRT1443291	hsa-miR-542-3p	CLIP-seq
MIRT1443292	hsa-miR-544b	CLIP-seq
MIRT2353674	hsa-miR-548ah	CLIP-seq
MIRT2353675	hsa-miR-548o	CLIP-seq
MIRT2353676	hsa-miR-550a	CLIP-seq
MIRT2353677	hsa-miR-552	CLIP-seq
MIRT2353678	hsa-miR-557	CLIP-seq
MIRT1443295	hsa-miR-588	CLIP-seq
MIRT2132658	hsa-miR-590-3p	CLIP-seq
MIRT2353679	hsa-miR-610	CLIP-seq
MIRT1443296	hsa-miR-612	CLIP-seq
MIRT2132659	hsa-miR-622	CLIP-seq
MIRT1443297	hsa-miR-639	CLIP-seq
MIRT1443298	hsa-miR-650	CLIP-seq
MIRT2353680	hsa-miR-654-3p	CLIP-seq
MIRT1443299	hsa-miR-654-5p	CLIP-seq
MIRT1443300	hsa-miR-661	CLIP-seq
MIRT1443302	hsa-miR-720	CLIP-seq
MIRT1443303	hsa-miR-759	CLIP-seq
MIRT2353681	hsa-miR-764	CLIP-seq
MIRT1443304	hsa-miR-766	CLIP-seq
MIRT1443305	hsa-miR-769-5p	CLIP-seq
MIRT1443307	hsa-miR-890	CLIP-seq
MIRT2132660	hsa-miR-941	CLIP-seq
MIRT2396124	hsa-miR-1207-3p	CLIP-seq
MIRT1443176	hsa-miR-1227	CLIP-seq
MIRT1443179	hsa-miR-1234	CLIP-seq
MIRT1443187	hsa-miR-150	CLIP-seq
MIRT1443212	hsa-miR-323-5p	CLIP-seq
MIRT1443224	hsa-miR-3672	CLIP-seq
MIRT1443232	hsa-miR-4252	CLIP-seq
MIRT1443236	hsa-miR-4269	CLIP-seq
MIRT1443244	hsa-miR-4438	CLIP-seq
MIRT1443275	hsa-miR-4772-3p	CLIP-seq
MIRT1443278	hsa-miR-4786-5p	CLIP-seq
MIRT1443279	hsa-miR-4793-3p	CLIP-seq
MIRT1443280	hsa-miR-4797-5p	CLIP-seq
MIRT1443286	hsa-miR-508-5p	CLIP-seq
MIRT1443287	hsa-miR-5095	CLIP-seq
MIRT2132657	hsa-miR-516b	CLIP-seq
MIRT1443288	hsa-miR-520g	CLIP-seq
MIRT1443289	hsa-miR-520h	CLIP-seq
MIRT1443297	hsa-miR-639	CLIP-seq
MIRT2396125	hsa-miR-646	CLIP-seq
MIRT1443302	hsa-miR-720	CLIP-seq
MIRT1443304	hsa-miR-766	CLIP-seq
MIRT1443305	hsa-miR-769-5p	CLIP-seq
MIRT1443306	hsa-miR-876-3p	CLIP-seq
MIRT1443203	hsa-miR-3163	CLIP-seq
MIRT2353661	hsa-miR-3652	CLIP-seq
MIRT2462073	hsa-miR-3907	CLIP-seq
MIRT2353666	hsa-miR-4430	CLIP-seq
MIRT2462074	hsa-miR-4662a-5p	CLIP-seq
MIRT2462075	hsa-miR-4676-5p	CLIP-seq
MIRT2462076	hsa-miR-4684-5p	CLIP-seq
MIRT1443271	hsa-miR-4755-3p	CLIP-seq
MIRT2462077	hsa-miR-548c-3p	CLIP-seq
MIRT2462078	hsa-miR-575	CLIP-seq
MIRT1443203	hsa-miR-3163	CLIP-seq
MIRT2462074	hsa-miR-4662a-5p	CLIP-seq
MIRT2462075	hsa-miR-4676-5p	CLIP-seq
MIRT2462076	hsa-miR-4684-5p	CLIP-seq
MIRT1443271	hsa-miR-4755-3p	CLIP-seq
MIRT2462077	hsa-miR-548c-3p	CLIP-seq
MIRT2462078	hsa-miR-575	CLIP-seq
MIRT1443168	hsa-miR-10a	CLIP-seq
MIRT1443169	hsa-miR-10b	CLIP-seq
MIRT1443180	hsa-miR-1254	CLIP-seq
MIRT1443181	hsa-miR-1262	CLIP-seq
MIRT1443183	hsa-miR-1285	CLIP-seq
MIRT1443188	hsa-miR-1827	CLIP-seq
MIRT1443190	hsa-miR-1912	CLIP-seq
MIRT2132648	hsa-miR-2114	CLIP-seq
MIRT2647816	hsa-miR-2276	CLIP-seq
MIRT2353651	hsa-miR-24	CLIP-seq
MIRT1443193	hsa-miR-2467-3p	CLIP-seq
MIRT1443198	hsa-miR-3116	CLIP-seq
MIRT1443200	hsa-miR-3122	CLIP-seq
MIRT1443201	hsa-miR-3130-5p	CLIP-seq
MIRT2132650	hsa-miR-3149	CLIP-seq
MIRT2647817	hsa-miR-3157-3p	CLIP-seq
MIRT1443203	hsa-miR-3163	CLIP-seq
MIRT1443205	hsa-miR-3170	CLIP-seq
MIRT1443208	hsa-miR-3187-5p	CLIP-seq
MIRT1443211	hsa-miR-3202	CLIP-seq
MIRT2647818	hsa-miR-338-3p	CLIP-seq
MIRT1443214	hsa-miR-339-5p	CLIP-seq
MIRT2647819	hsa-miR-346	CLIP-seq
MIRT2353658	hsa-miR-3607-3p	CLIP-seq
MIRT2353659	hsa-miR-3609	CLIP-seq
MIRT1443215	hsa-miR-3612	CLIP-seq
MIRT1443217	hsa-miR-3622a-3p	CLIP-seq
MIRT1443218	hsa-miR-3622b-3p	CLIP-seq
MIRT2353660	hsa-miR-3622b-5p	CLIP-seq
MIRT1443224	hsa-miR-3672	CLIP-seq
MIRT2353662	hsa-miR-3686	CLIP-seq
MIRT1443225	hsa-miR-3689a-3p	CLIP-seq
MIRT1443226	hsa-miR-3689c	CLIP-seq
MIRT1443229	hsa-miR-3913-5p	CLIP-seq
MIRT2353663	hsa-miR-3926	CLIP-seq
MIRT1443233	hsa-miR-4257	CLIP-seq
MIRT1443234	hsa-miR-4258	CLIP-seq
MIRT1443236	hsa-miR-4269	CLIP-seq
MIRT2132651	hsa-miR-4284	CLIP-seq
MIRT2647820	hsa-miR-4288	CLIP-seq
MIRT1443241	hsa-miR-4433	CLIP-seq
MIRT1443244	hsa-miR-4438	CLIP-seq
MIRT1443246	hsa-miR-4459	CLIP-seq
MIRT1443249	hsa-miR-4482	CLIP-seq
MIRT2647821	hsa-miR-4530	CLIP-seq
MIRT1443253	hsa-miR-4533	CLIP-seq
MIRT2462074	hsa-miR-4662a-5p	CLIP-seq
MIRT2462075	hsa-miR-4676-5p	CLIP-seq
MIRT2462076	hsa-miR-4684-5p	CLIP-seq
MIRT1443262	hsa-miR-4701-3p	CLIP-seq
MIRT1443264	hsa-miR-4715-3p	CLIP-seq
MIRT1443265	hsa-miR-4725-5p	CLIP-seq
MIRT1443267	hsa-miR-4728-5p	CLIP-seq
MIRT2132655	hsa-miR-4735-5p	CLIP-seq
MIRT1443271	hsa-miR-4755-3p	CLIP-seq
MIRT1443273	hsa-miR-4768-3p	CLIP-seq
MIRT1443275	hsa-miR-4772-3p	CLIP-seq
MIRT2132656	hsa-miR-4775	CLIP-seq
MIRT1443278	hsa-miR-4786-5p	CLIP-seq
MIRT1443279	hsa-miR-4793-3p	CLIP-seq
MIRT1443280	hsa-miR-4797-5p	CLIP-seq
MIRT1443281	hsa-miR-4803	CLIP-seq
MIRT1443283	hsa-miR-498	CLIP-seq
MIRT1443284	hsa-miR-504	CLIP-seq
MIRT1443286	hsa-miR-508-5p	CLIP-seq
MIRT1443287	hsa-miR-5095	CLIP-seq
MIRT1443288	hsa-miR-520g	CLIP-seq
MIRT1443289	hsa-miR-520h	CLIP-seq
MIRT1443290	hsa-miR-541	CLIP-seq
MIRT1443291	hsa-miR-542-3p	CLIP-seq
MIRT1443292	hsa-miR-544b	CLIP-seq
MIRT2353674	hsa-miR-548ah	CLIP-seq
MIRT2462077	hsa-miR-548c-3p	CLIP-seq
MIRT2462078	hsa-miR-575	CLIP-seq
MIRT2132658	hsa-miR-590-3p	CLIP-seq
MIRT2647822	hsa-miR-604	CLIP-seq
MIRT1443296	hsa-miR-612	CLIP-seq
MIRT2647823	hsa-miR-632	CLIP-seq
MIRT2647824	hsa-miR-647	CLIP-seq
MIRT1443298	hsa-miR-650	CLIP-seq
MIRT2353680	hsa-miR-654-3p	CLIP-seq
MIRT1443299	hsa-miR-654-5p	CLIP-seq
MIRT1443300	hsa-miR-661	CLIP-seq
MIRT1443303	hsa-miR-759	CLIP-seq
MIRT1443304	hsa-miR-766	CLIP-seq
MIRT1443305	hsa-miR-769-5p	CLIP-seq
MIRT1443168	hsa-miR-10a	CLIP-seq
MIRT1443169	hsa-miR-10b	CLIP-seq
MIRT1443188	hsa-miR-1827	CLIP-seq
MIRT1443190	hsa-miR-1912	CLIP-seq
MIRT1443193	hsa-miR-2467-3p	CLIP-seq
MIRT1443200	hsa-miR-3122	CLIP-seq
MIRT1443201	hsa-miR-3130-5p	CLIP-seq
MIRT2132650	hsa-miR-3149	CLIP-seq
MIRT1443203	hsa-miR-3163	CLIP-seq
MIRT1443205	hsa-miR-3170	CLIP-seq
MIRT1443214	hsa-miR-339-5p	CLIP-seq
MIRT2353658	hsa-miR-3607-3p	CLIP-seq
MIRT1443215	hsa-miR-3612	CLIP-seq
MIRT1443217	hsa-miR-3622a-3p	CLIP-seq
MIRT1443218	hsa-miR-3622b-3p	CLIP-seq
MIRT1443224	hsa-miR-3672	CLIP-seq
MIRT2353662	hsa-miR-3686	CLIP-seq
MIRT1443225	hsa-miR-3689a-3p	CLIP-seq
MIRT1443226	hsa-miR-3689c	CLIP-seq
MIRT1443229	hsa-miR-3913-5p	CLIP-seq
MIRT1443233	hsa-miR-4257	CLIP-seq
MIRT1443234	hsa-miR-4258	CLIP-seq
MIRT1443236	hsa-miR-4269	CLIP-seq
MIRT1443241	hsa-miR-4433	CLIP-seq
MIRT1443244	hsa-miR-4438	CLIP-seq
MIRT1443246	hsa-miR-4459	CLIP-seq
MIRT1443249	hsa-miR-4482	CLIP-seq
MIRT2462074	hsa-miR-4662a-5p	CLIP-seq
MIRT2462075	hsa-miR-4676-5p	CLIP-seq
MIRT2462076	hsa-miR-4684-5p	CLIP-seq
MIRT1443264	hsa-miR-4715-3p	CLIP-seq
MIRT1443265	hsa-miR-4725-5p	CLIP-seq
MIRT1443267	hsa-miR-4728-5p	CLIP-seq
MIRT2132655	hsa-miR-4735-5p	CLIP-seq
MIRT1443271	hsa-miR-4755-3p	CLIP-seq
MIRT1443273	hsa-miR-4768-3p	CLIP-seq
MIRT1443275	hsa-miR-4772-3p	CLIP-seq
MIRT2132656	hsa-miR-4775	CLIP-seq
MIRT1443278	hsa-miR-4786-5p	CLIP-seq
MIRT1443280	hsa-miR-4797-5p	CLIP-seq
MIRT1443284	hsa-miR-504	CLIP-seq
MIRT1443287	hsa-miR-5095	CLIP-seq
MIRT1443290	hsa-miR-541	CLIP-seq
MIRT1443292	hsa-miR-544b	CLIP-seq
MIRT2462077	hsa-miR-548c-3p	CLIP-seq
MIRT2462078	hsa-miR-575	CLIP-seq
MIRT2132658	hsa-miR-590-3p	CLIP-seq
MIRT1443297	hsa-miR-639	CLIP-seq
MIRT1443298	hsa-miR-650	CLIP-seq
MIRT2353680	hsa-miR-654-3p	CLIP-seq
MIRT1443299	hsa-miR-654-5p	CLIP-seq
MIRT1443302	hsa-miR-720	CLIP-seq
MIRT1443303	hsa-miR-759	CLIP-seq
MIRT1443305	hsa-miR-769-5p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	12706838
RELA	Unknown	12706838

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8262389
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	8639902
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8639902
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0033084	Process	Regulation of immature T cell proliferation in thymus	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	8262389
GO:0042127	Process	Regulation of cell population proliferation	IBA

MIM	HGNC	e!Ensembl
602250	11924	ENSG00000049249

Q07011

Protein name

Tumor necrosis factor receptor superfamily member 9 (4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)

Protein function

Receptor for TNFSF9/4-1BBL. Conveys a signal that enhances CD8(+) T-cell survival, cytotoxicity, and mitochondrial activity, thereby promoting immunity against viruses and tumors (Probable).

PDB

6A3V , 6A3W , 6BWV , 6CPR , 6CU0 , 6MGP , 6MHR , 6MI2 , 6Y8K , 7D4B , 7YXU , 8GYE , 8OZ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	48 → 86	TNFR/NGFR cysteine-rich region	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on the surface of activated T-cells. {ECO:0000269|PubMed:30872117}.

Sequence

MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGGCEL

Sequence length

255

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		TNFs bind their physiological receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Lymphoma	Pathogenic	rs754024907	RCV005925552	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Squamous cell carcinoma of the head and neck	Pathogenic	rs754024907	RCV005925551	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TNFRSF9-related disorder	Likely pathogenic; Pathogenic	rs1639761448	RCV002291303	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-INDUCED LYMPHOPROLIFERATIVE DISEASE DUE TO CD137 DEFICIENCY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 109 with lymphoproliferation	Uncertain significance	ClinVar CTD, ClinGen, ClinVar, Disgenet, HPO CTD, ClinGen, ClinVar, Disgenet, HPO CTD, ClinGen, ClinVar, Disgenet, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (182)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22282196, 30359586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	29861382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14961035, 27548616, 29637550, 29861382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27388616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18461674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31201235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14961035, 29861382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	31058559, 31616638		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28947567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18285570, 25032953, 28288971, 28747613, 28755037, 29571029, 30778712, 30978132, 31177061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28681901, 31875586, 33800462, 9485208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35812455	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	26626624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20600327, 22519594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18285570, 25032953, 28288971, 28747613, 28755037, 29571029, 30778712, 30978132, 31177061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25032953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	14599849, 15998581, 24958847, 28347235, 31297111, 31740402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18519814, 28347235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19608748, 26195067, 28115358, 31307539, 31650026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	18768897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30228944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	29697202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22797667, 31244935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27831501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39351539	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	35558159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14716821, 31353502, 37632959, 38042211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	37270937	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31625289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33335029, 37868997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36585453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37256126	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33178496, 33537169, 35279104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18461674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30065096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29571029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	25032953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	25298177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	25298177	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	30778712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	14961035, 29861382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	18094369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21832238, 29503204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24885856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20309938, 31741755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	25279216		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24837434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15638367, 16596186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10760795, 33190167, 34146579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	12100033	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31574023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30359586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30359586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30359586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	30359586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31697826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15308117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	15308117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	19626699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14599849, 15998581, 28755037, 30867509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14599849, 15998581, 28755037, 30867509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20529823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15998581, 28363905, 30867509, 31787971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30250206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	14599849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	21670469, 25444722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36199963, 40088713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27577071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36359828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	23904171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40429753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26450624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17934521, 26450624, 26601952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17934521, 40429753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	16931626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28067900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27496866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27496866, 27831501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	30194255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	34685651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	22901750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31058559, 31616638, 8656679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35112462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24919573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28755037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19719389, 24888271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19759901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22077621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37928542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20008791, 27388616, 27548616, 29409351, 29861382, 30288351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	31545280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	35558159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14716821, 18461674, 21059892, 31353502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14716821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21059892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31625289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31297111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33777025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37114204	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31297111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31297111, 31500130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31297111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36359828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	19719389, 22308288, 29146881, 31501153		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lymphoma	Lymphoma	Pubtator	22308288, 22901750	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lymphoma Follicular	Lymphoma	Pubtator	23775959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	27831501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	30194255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	31537641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27496866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22308288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22797667, 31244935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31625289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30065096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28947567, 30424804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28674082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30321186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10604232, 11927939, 14671675, 14961035, 18461674, 19719389, 21304403, 22017440, 22204816, 22532596, 24045181, 24958847, 26493961, 27831501, 28082401 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31741755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22308288		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20708974, 22532596, 23560068, 24045181, 26493961, 27160390, 27846884, 29298689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23560068, 32028068, 35894206, 40621453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19626699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28928380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29308300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17309825, 29089645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21565182, 31194697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34021248	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16970683, 33240262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18727631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18727631	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31695700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30635789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	19233196		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33530452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11447378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10604232, 11927939, 14716821, 16942440, 18060045, 18461674, 18779748, 19384291, 19435920, 19773745, 20309938, 20387166, 21546571, 21877247, 22532596 View all (48 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26298772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25631633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29744298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28659311, 30995926		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30065096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38290413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28947567, 30424804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27777771, 30596643, 31288851, 36585453, 37339979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37834363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	27365313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28674082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	26993768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35365620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	22416920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26626624		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24885856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30250465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31574023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	33643694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15031666, 18668547		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	9485208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	35558159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30194255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30021910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18461674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27777979, 32304268, 37108276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27777979		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30321186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	25279216		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	30321186, 34767045	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	24899613, 29697202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	18838252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28473315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29980239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15308117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39201462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	38191418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Young Syndrome	Young syndrome	Pubtator	30872117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TNFRSF9 (TNF receptor superfamily member 9)