IL16 (interleukin 16)

Gene

• Entrez ID: 3603
• Gene name: Interleukin 16
• Gene symbol: IL16
• Synonyms (NCBI Gene): LCF, NIL16, PRIL16, prIL-16
• Chromosome: 15
• Chromosome location: 15q25.1
• Summary: The protein encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. The signaling process of this cytokine is mediated by CD4. The product of this gene unde

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1063750	hsa-miR-1285	CLIP-seq
MIRT1063751	hsa-miR-3187-5p	CLIP-seq
MIRT1063752	hsa-miR-4252	CLIP-seq
MIRT1063753	hsa-miR-4646-5p	CLIP-seq
MIRT1063754	hsa-miR-4691-3p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT1063756	hsa-miR-612	CLIP-seq
MIRT1063757	hsa-miR-671-5p	CLIP-seq
MIRT1063758	hsa-miR-101	CLIP-seq
MIRT1063759	hsa-miR-1207-3p	CLIP-seq
MIRT1063760	hsa-miR-134	CLIP-seq
MIRT1063761	hsa-miR-144	CLIP-seq
MIRT1063762	hsa-miR-1827	CLIP-seq
MIRT1063763	hsa-miR-1913	CLIP-seq
MIRT1063764	hsa-miR-199a-5p	CLIP-seq
MIRT1063765	hsa-miR-199b-5p	CLIP-seq
MIRT1063766	hsa-miR-22	CLIP-seq
MIRT1063767	hsa-miR-223	CLIP-seq
MIRT1063768	hsa-miR-2909	CLIP-seq
MIRT1063769	hsa-miR-3118	CLIP-seq
MIRT1063770	hsa-miR-3149	CLIP-seq
MIRT1063771	hsa-miR-3162-5p	CLIP-seq
MIRT1063772	hsa-miR-3164	CLIP-seq
MIRT1063773	hsa-miR-324-3p	CLIP-seq
MIRT1063774	hsa-miR-3612	CLIP-seq
MIRT1063775	hsa-miR-3622a-3p	CLIP-seq
MIRT1063776	hsa-miR-3622b-3p	CLIP-seq
MIRT1063777	hsa-miR-425	CLIP-seq
MIRT1063752	hsa-miR-4252	CLIP-seq
MIRT1063778	hsa-miR-4313	CLIP-seq
MIRT1063779	hsa-miR-4443	CLIP-seq
MIRT1063780	hsa-miR-4493	CLIP-seq
MIRT1063781	hsa-miR-4520a-5p	CLIP-seq
MIRT1063782	hsa-miR-4520b-5p	CLIP-seq
MIRT1063783	hsa-miR-4697-3p	CLIP-seq
MIRT1063784	hsa-miR-4717-5p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT1063785	hsa-miR-4753-5p	CLIP-seq
MIRT1063786	hsa-miR-4802-5p	CLIP-seq
MIRT1063787	hsa-miR-490-3p	CLIP-seq
MIRT1063788	hsa-miR-582-5p	CLIP-seq
MIRT1063789	hsa-miR-642b	CLIP-seq
MIRT1063790	hsa-miR-649	CLIP-seq
MIRT1063791	hsa-miR-650	CLIP-seq
MIRT1063792	hsa-miR-935	CLIP-seq
MIRT1063793	hsa-miR-940	CLIP-seq
MIRT1063784	hsa-miR-4717-5p	CLIP-seq
MIRT2015107	hsa-miR-1972	CLIP-seq
MIRT2015108	hsa-miR-3183	CLIP-seq
MIRT2015109	hsa-miR-3190	CLIP-seq
MIRT2015110	hsa-miR-3202	CLIP-seq
MIRT2015111	hsa-miR-339-5p	CLIP-seq
MIRT2015112	hsa-miR-3921	CLIP-seq
MIRT2015113	hsa-miR-4290	CLIP-seq
MIRT2015114	hsa-miR-4480	CLIP-seq
MIRT2015115	hsa-miR-4533	CLIP-seq
MIRT2015116	hsa-miR-4653-5p	CLIP-seq
MIRT2015117	hsa-miR-4662a-5p	CLIP-seq
MIRT2015118	hsa-miR-4723-3p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT2015119	hsa-miR-4763-5p	CLIP-seq
MIRT2247393	hsa-miR-1271	CLIP-seq
MIRT2247394	hsa-miR-4435	CLIP-seq
MIRT2247395	hsa-miR-4645-5p	CLIP-seq
MIRT2247396	hsa-miR-4673	CLIP-seq
MIRT2247397	hsa-miR-4755-3p	CLIP-seq
MIRT2247398	hsa-miR-96	CLIP-seq
MIRT1063750	hsa-miR-1285	CLIP-seq
MIRT1063751	hsa-miR-3187-5p	CLIP-seq
MIRT1063752	hsa-miR-4252	CLIP-seq
MIRT1063753	hsa-miR-4646-5p	CLIP-seq
MIRT1063754	hsa-miR-4691-3p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT1063756	hsa-miR-612	CLIP-seq
MIRT1063757	hsa-miR-671-5p	CLIP-seq
MIRT2389345	hsa-miR-3679-3p	CLIP-seq
MIRT2429983	hsa-miR-125a-3p	CLIP-seq
MIRT2015107	hsa-miR-1972	CLIP-seq
MIRT2429984	hsa-miR-4323	CLIP-seq
MIRT2429985	hsa-miR-4530	CLIP-seq
MIRT2429986	hsa-miR-4650-5p	CLIP-seq
MIRT2429987	hsa-miR-4726-3p	CLIP-seq
MIRT2451703	hsa-miR-4485	CLIP-seq
MIRT2451704	hsa-miR-95	CLIP-seq
MIRT2465475	hsa-miR-1245b-5p	CLIP-seq
MIRT2465476	hsa-miR-15a	CLIP-seq
MIRT2465477	hsa-miR-15b	CLIP-seq
MIRT2465478	hsa-miR-16	CLIP-seq
MIRT2465479	hsa-miR-195	CLIP-seq
MIRT2465480	hsa-miR-3064-5p	CLIP-seq
MIRT2465481	hsa-miR-3142	CLIP-seq
MIRT2465482	hsa-miR-424	CLIP-seq
MIRT2465483	hsa-miR-4524	CLIP-seq
MIRT2465484	hsa-miR-497	CLIP-seq
MIRT2465485	hsa-miR-503	CLIP-seq
MIRT2465486	hsa-miR-646	CLIP-seq
MIRT2682760	hsa-miR-1224-3p	CLIP-seq
MIRT2682761	hsa-miR-145	CLIP-seq
MIRT2015111	hsa-miR-339-5p	CLIP-seq
MIRT2682762	hsa-miR-4286	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	9144227
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	IDA
GO:0006935	Process	Chemotaxis	IEA
GO:0006955	Process	Immune response	TAS	9144227
GO:0016607	Component	Nuclear speck	IDA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS	30089723
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0032730	Process	Positive regulation of interleukin-1 alpha production	IDA	30634164
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	30634164
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	30634164
GO:0042609	Function	CD4 receptor binding	IBA
GO:0042609	Function	CD4 receptor binding	IPI	24942581
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	30634164
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0051924	Process	Regulation of calcium ion transport	IDA	24942581
GO:0090543	Component	Flemming body	IDA
GO:1902565	Process	Positive regulation of neutrophil activation	ISS	30089723

Other IDs

• MIM: 603035
• HGNC: 5980
• e!Ensembl: ENSG00000172349

Protein

• UniProt ID: Q14005
• Protein name: Pro-interleukin-16 [Cleaved into: Interleukin-16 (IL-16) (Lymphocyte chemoattractant factor) (LCF)]
• Protein function: Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4.; [Is
• PDB: 1I16, 1X6D, 5FB8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	216 → 300	PDZ domain	Domain
  PF00595	PDZ	1113 → 1195	PDZ domain	Domain
  PF00595	PDZ	1234 → 1317	PDZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 3]: Expressed in hemopoietic tissues, such as resting T-cells, but undetectable during active T-cell proliferation.
• Sequence:

  MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSS
  VQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEA
  QSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQL
  DCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYG
  PIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKGLLTLTVR
  TRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNYRIMVEVSLQK
  EAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE
  VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLES
  SWHGRPTLEKEREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDIS
  THSPSLPLAREPVVLSIASSRLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPP
  PRKYFKSDSDPQKSLEERENSSCSSGHTPPTCGQEARELLPLLLPQEDTAGRSPSASAGC
  PGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDC
  IKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKVYKSADSSTVK
  KGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR
  QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQP
  EQVLSSGSPAASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMP
  SQRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKE
  GASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDGDHSSLQSGQS
  VISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVIT
  VHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTP
  EAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP
  LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKS
  LQSKETTAAGDS

• Sequence length: 1332

Pathways

KEGG:

Cytokine-cytokine receptor interaction

Reactome:

Other interleukin signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	22445829		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21818556		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	21818556		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	24320753		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	24320753		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30193587	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	26386715, 29108295		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	14657881		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18446062, 19279017, 22355377	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	9754554	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10394103, 10857846, 10932073, 15784111, 16387589, 31120548, 9271307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	10809960, 17303923, 20307249	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11709514	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28821884	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30203815		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	25346392		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30456538		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30456538		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10857846, 16410300, 18394967, 19298795, 22019522, 24320753, 24969906, 28151028, 29328375, 30936868		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24138069, 29328375, 30936868	Associate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	14657881		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	24380743		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	15320912	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	24288444	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23241166, 23893766		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37910571	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32606144, 37929521	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34897107	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25597281		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26823871	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	40612864	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24380743		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34927450	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24288444		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24288444	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24465869		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24465869		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30168369	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19074885		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24138069		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	17431659		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	11040184, 23817423		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	11171821, 37228614	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19073878, 22187702, 22939228		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22187702, 26764183, 33779485, 38291041	Associate	★☆☆☆☆ Found in Text Mining only
Common ventricle	Complete Atrioventricular Canal Defect	BEFREE	28218352		★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival Diseases	BEFREE	27897453		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20529140, 31242814		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	30829721	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21214401, 21703255, 23195133, 23881440		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21214401, 21703255, 23195133, 23881440		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23881440, 32223966	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	23881440	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21214401, 21703255, 23195133, 23881440		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11040184, 12706406		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11709514	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11121549, 11196512, 15319533, 18446062, 19279017		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	9802374		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	14657881, 28382616		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	LHGDN	14657881		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11196708, 11714796, 11941319, 14657881, 9802374		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	11714796, 15560757		★☆☆☆☆ Found in Text Mining only
Dermatitis, Irritant	Dermatitis	BEFREE	28382616		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28580570	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26823871	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31375554	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31375554		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	18394967		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	28393177		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11196708, 11714796, 11941319, 14657881, 9802374		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	24138069	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	15175077		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15820794		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20662556, 27484651, 29328375		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29328375, 37170270	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26820987	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25166752, 30297770		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37929521	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31067541	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	39201599	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12794168, 12810540, 16410300, 18394967, 24694201		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	18832736, 25940130	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	22506015	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	25940130, 35720300	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26823871	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23894370, 24288444		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	24288444	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28490023, 30205414		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31067541		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30456538		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	30936868		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	9084796, 9788673		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11040184, 11171821, 12706406, 23817423		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11171821, 37228614	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26764183	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	9802374		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	24551286		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24551286	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	24551286, 24971599	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31345839		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24288444		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	35673992	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	27157003	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34783463	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24471420	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22019522		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28425483	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20307249, 24138069	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24138069		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25597281, 30671474, 32354900	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11999883		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	33931094	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19440200	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36104119	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11999883		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11196708, 11999883, 19298795, 19440200, 30089723		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	11999883		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	34783463, 36104119	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11999883		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	15342983		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	LHGDN	15342983		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	21818556		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19066394		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	10949545, 22080865, 23893766		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23241166, 23893766		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26823871, 27323152		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25597281		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24380743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18264096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22923025, 24061634, 29594819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19073878, 24175812, 26346169, 28990054		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20529140, 21818556, 22745469, 22923025, 23893766, 24328527, 24568499, 24969906, 26842762, 27484651		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24465869		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32606144	Associate	★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	12810540		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12191564, 14755377		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22745469, 23893766, 28512269		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28512269	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28151028		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	10504456	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19758567, 24101193		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24101193	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10949545, 19758567, 20093405, 20529140, 21818556, 23241166, 27323152		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	28445879		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27498158, 28807247, 28930110		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25710036	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27319430		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37259724	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	25954818	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	25954818, 28910372, 29281738		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27703190		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27703190	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35497879	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24380743		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28574850		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	28574850	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	15320912	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	15886011		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	16178875		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	16178875		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	16178875, 32915917	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21818556		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	22080865		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28425483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	28425483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	22923025, 24061634, 29594819		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18264096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18264096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22923025, 24061634	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	27788245		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24138069	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25125975	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	34483727	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24138069		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20529140, 26823871, 27323152, 31242814		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	30193587	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	32542038	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	33371882	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	39472110	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11121549, 11196512, 15319533, 18446062, 19279017		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	14705216, 18446062		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	20307249	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	35215488	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	18438864		★☆☆☆☆ Found in Text Mining only
Single Ventricle Defect	Single Ventricle Defect	BEFREE	28218352		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	10504456	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10504456, 9802374		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30671474	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18950955		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29095267		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19073878, 24175812, 26346169, 28990054		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24175812, 26346169, 34968167, 35215488, 38148080	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39173282	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35673992	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	24320753		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18438864, 31377804		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10949545		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	28574850	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	27832278		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	27245471		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27245471	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30096224		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11040184, 11171821		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32862475	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24465869	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24465869	Stimulate	★☆☆☆☆ Found in Text Mining only
Whipple Disease	Whipple disease	Pubtator	17551575, 21364641	Stimulate	★☆☆☆☆ Found in Text Mining only