Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3601
Gene name	Interleukin 15 receptor subunit alpha
Gene symbol	IL15RA
Synonyms (NCBI Gene)	CD215
Chromosome	10
Chromosome location	10p15.1
Summary	This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735808	hsa-miR-370-3p	Luciferase reporter assay	31513636
MIRT1063731	hsa-miR-1225-5p	CLIP-seq
MIRT1063732	hsa-miR-150	CLIP-seq
MIRT1063733	hsa-miR-2054	CLIP-seq
MIRT1063734	hsa-miR-4312	CLIP-seq
MIRT1063735	hsa-miR-4434	CLIP-seq
MIRT1063736	hsa-miR-4516	CLIP-seq
MIRT1063737	hsa-miR-4713-5p	CLIP-seq
MIRT1063738	hsa-miR-4768-3p	CLIP-seq
MIRT1063739	hsa-miR-4768-5p	CLIP-seq
MIRT1063740	hsa-miR-532-3p	CLIP-seq
MIRT1063741	hsa-miR-662	CLIP-seq
MIRT1063742	hsa-miR-665	CLIP-seq
MIRT1063743	hsa-miR-668	CLIP-seq
MIRT1063744	hsa-miR-1224-3p	CLIP-seq
MIRT1063745	hsa-miR-1260	CLIP-seq
MIRT1063746	hsa-miR-1260b	CLIP-seq
MIRT1063747	hsa-miR-1280	CLIP-seq
MIRT1063732	hsa-miR-150	CLIP-seq
MIRT1063748	hsa-miR-1915	CLIP-seq
MIRT1063737	hsa-miR-4713-5p	CLIP-seq
MIRT1063749	hsa-miR-4726-3p	CLIP-seq
MIRT1063740	hsa-miR-532-3p	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015102	hsa-miR-205	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT2550876	hsa-miR-1200	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT2550877	hsa-miR-185	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015102	hsa-miR-205	CLIP-seq
MIRT2550878	hsa-miR-219-1-3p	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2550879	hsa-miR-3140-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2550880	hsa-miR-4306	CLIP-seq
MIRT2550881	hsa-miR-4644	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2550882	hsa-miR-4659a-3p	CLIP-seq
MIRT2550883	hsa-miR-4659b-3p	CLIP-seq
MIRT2550884	hsa-miR-4682	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT2550885	hsa-miR-4778-3p	CLIP-seq
MIRT2550886	hsa-miR-500a	CLIP-seq
MIRT2550887	hsa-miR-571	CLIP-seq
MIRT2550888	hsa-miR-639	CLIP-seq
MIRT2550876	hsa-miR-1200	CLIP-seq
MIRT1063744	hsa-miR-1224-3p	CLIP-seq
MIRT1063745	hsa-miR-1260	CLIP-seq
MIRT1063746	hsa-miR-1260b	CLIP-seq
MIRT1063747	hsa-miR-1280	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1063732	hsa-miR-150	CLIP-seq
MIRT2550877	hsa-miR-185	CLIP-seq
MIRT1063748	hsa-miR-1915	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015102	hsa-miR-205	CLIP-seq
MIRT2550878	hsa-miR-219-1-3p	CLIP-seq
MIRT2682755	hsa-miR-24	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2550879	hsa-miR-3140-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2682756	hsa-miR-378g	CLIP-seq
MIRT2550880	hsa-miR-4306	CLIP-seq
MIRT2682757	hsa-miR-4310	CLIP-seq
MIRT2682758	hsa-miR-4437	CLIP-seq
MIRT2550881	hsa-miR-4644	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2550882	hsa-miR-4659a-3p	CLIP-seq
MIRT2550883	hsa-miR-4659b-3p	CLIP-seq
MIRT2682759	hsa-miR-4674	CLIP-seq
MIRT2550884	hsa-miR-4682	CLIP-seq
MIRT1063737	hsa-miR-4713-5p	CLIP-seq
MIRT1063749	hsa-miR-4726-3p	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT2550885	hsa-miR-4778-3p	CLIP-seq
MIRT2550886	hsa-miR-500a	CLIP-seq
MIRT1063740	hsa-miR-532-3p	CLIP-seq
MIRT2550887	hsa-miR-571	CLIP-seq
MIRT2550888	hsa-miR-639	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0004896	Function	Cytokine receptor activity	TAS	7641685
GO:0005515	Function	Protein binding	IPI	16284400, 23104097
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005768	Component	Endosome	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0009986	Component	Cell surface	IDA	15123770
GO:0009986	Component	Cell surface	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	15123770
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IBA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IMP	15123770
GO:0042010	Function	Interleukin-15 receptor activity	IBA
GO:0042010	Function	Interleukin-15 receptor activity	IDA	15123770
GO:0042010	Function	Interleukin-15 receptor activity	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IMP	15123770

MIM	HGNC	e!Ensembl
601070	5978	ENSG00000134470

Q13261

Protein name

Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]

Protein function

High-affinity receptor for interleukin-15 (PubMed:8530383). Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells (By similarity). In neutrophils, binds and activates kinase SYK

PDB

2ERS , 2Z3Q , 2Z3R , 4GS7

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in neutrophils (at protein level) (PubMed:15123770). Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus (PubMed:12114302). Higher levels of soluble sIL-15RA form in c

Sequence

MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL

Sequence length

267

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Intestinal immune network for IgA production Human T-cell leukemia virus 1 infection Pathways in cancer		Interleukin-15 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (80)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	39457093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24696261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31244423		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	27837366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27837366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25879761, 30407753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	11714793		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	30068596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23618691, 29396044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23996684, 30988805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23996684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	32793194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	27794069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28738233, 31622625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31622625	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	17635814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30068596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29676596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23039249	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31760731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27794069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24603895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24603895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24603895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24603895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22128034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23039249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23039249	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24019554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28821884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28821884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31127035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31127035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26853723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28940555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28821884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	20381491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	20381491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24464181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24464181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	23039249, 28738233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17635814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23039249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23039249, 27794069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	24019554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15651075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30482760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	21304101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	21041729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23996684, 30988805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24464181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30064894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24572789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24980552, 30444200, 30833178, 30988805, 31760731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31760731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24572789		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30833178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37334356, 37923822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18514540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23285013, 23996684, 24572789, 29255466, 30064894, 30587590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32599975	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32793194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19309557, 33487124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE	Ossification Of The Posterior Longitudinal Ligament Of Spine	BEFREE	25387549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32793194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31991061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	11160322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	39221259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	27374114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24572789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24019554		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30407753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31244423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia, Catatonic	Schizophrenia	BEFREE	31244423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24464181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24696261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	22049515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24980552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23039249		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

IL15RA (interleukin 15 receptor subunit alpha)