IL15 (interleukin 15)

Gene

• Entrez ID: 3600
• Gene name: Interleukin 15
• Gene symbol: IL15
• Synonyms (NCBI Gene): IL-15
• Chromosome: 4
• Chromosome location: 4q31.21
• Summary: The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024918	hsa-miR-215-5p	Microarray	19074876
MIRT026532	hsa-miR-192-5p	Microarray	19074876
MIRT724031	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT724030	hsa-miR-5688	HITS-CLIP	19536157
MIRT724029	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT724028	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT724027	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724026	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724025	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724024	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT736114	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR	33066457
MIRT736423	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT724031	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT724030	hsa-miR-5688	HITS-CLIP	19536157
MIRT724029	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT724028	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT724027	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724026	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724025	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724024	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT1063727	hsa-miR-199a-3p	CLIP-seq
MIRT1063728	hsa-miR-199b-3p	CLIP-seq
MIRT1063729	hsa-miR-3129-5p	CLIP-seq
MIRT1063730	hsa-miR-936	CLIP-seq
MIRT2247390	hsa-miR-1264	CLIP-seq
MIRT2247391	hsa-miR-4251	CLIP-seq
MIRT2247392	hsa-miR-4329	CLIP-seq
MIRT2389340	hsa-miR-140-5p	CLIP-seq
MIRT1063727	hsa-miR-199a-3p	CLIP-seq
MIRT1063728	hsa-miR-199b-3p	CLIP-seq
MIRT1063729	hsa-miR-3129-5p	CLIP-seq
MIRT2389341	hsa-miR-4676-5p	CLIP-seq
MIRT2389342	hsa-miR-4697-3p	CLIP-seq
MIRT2389343	hsa-miR-4712-3p	CLIP-seq
MIRT2389344	hsa-miR-575	CLIP-seq
MIRT2550848	hsa-miR-105	CLIP-seq
MIRT2550849	hsa-miR-130a	CLIP-seq
MIRT2550850	hsa-miR-130b	CLIP-seq
MIRT2550851	hsa-miR-148a	CLIP-seq
MIRT2550852	hsa-miR-148b	CLIP-seq
MIRT2550853	hsa-miR-152	CLIP-seq
MIRT2550854	hsa-miR-301a	CLIP-seq
MIRT2550855	hsa-miR-301b	CLIP-seq
MIRT2550856	hsa-miR-3074-3p	CLIP-seq
MIRT2550857	hsa-miR-3620	CLIP-seq
MIRT2550858	hsa-miR-3666	CLIP-seq
MIRT2550859	hsa-miR-4295	CLIP-seq
MIRT2550860	hsa-miR-4502	CLIP-seq
MIRT2550861	hsa-miR-450b-5p	CLIP-seq
MIRT2550862	hsa-miR-454	CLIP-seq
MIRT2550863	hsa-miR-507	CLIP-seq
MIRT2550864	hsa-miR-548ac	CLIP-seq
MIRT2550865	hsa-miR-548ad	CLIP-seq
MIRT2550866	hsa-miR-548ae	CLIP-seq
MIRT2550867	hsa-miR-548aj	CLIP-seq
MIRT2550868	hsa-miR-548am	CLIP-seq
MIRT2550869	hsa-miR-548d-3p	CLIP-seq
MIRT2550870	hsa-miR-548x	CLIP-seq
MIRT2550871	hsa-miR-548z	CLIP-seq
MIRT2550872	hsa-miR-556-5p	CLIP-seq
MIRT2550873	hsa-miR-557	CLIP-seq
MIRT2550874	hsa-miR-610	CLIP-seq
MIRT2550875	hsa-miR-891b	CLIP-seq
MIRT2550848	hsa-miR-105	CLIP-seq
MIRT2682752	hsa-miR-2052	CLIP-seq
MIRT2550856	hsa-miR-3074-3p	CLIP-seq
MIRT2550857	hsa-miR-3620	CLIP-seq
MIRT2682753	hsa-miR-3659	CLIP-seq
MIRT2550860	hsa-miR-4502	CLIP-seq
MIRT2550861	hsa-miR-450b-5p	CLIP-seq
MIRT2550863	hsa-miR-507	CLIP-seq
MIRT2550864	hsa-miR-548ac	CLIP-seq
MIRT2550866	hsa-miR-548ae	CLIP-seq
MIRT2550867	hsa-miR-548aj	CLIP-seq
MIRT2550868	hsa-miR-548am	CLIP-seq
MIRT2550869	hsa-miR-548d-3p	CLIP-seq
MIRT2550870	hsa-miR-548x	CLIP-seq
MIRT2550871	hsa-miR-548z	CLIP-seq
MIRT2550872	hsa-miR-556-5p	CLIP-seq
MIRT2550873	hsa-miR-557	CLIP-seq
MIRT2550874	hsa-miR-610	CLIP-seq
MIRT2682754	hsa-miR-654-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HOXA10	Activation	20478621
MYB	Activation	11675351

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001787	Process	Natural killer cell proliferation	IEA
GO:0001819	Process	Positive regulation of cytokine production	IBA
GO:0001866	Process	NK T cell proliferation	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	9097905
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	16284400, 23104097, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9097905
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10851076
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10851076
GO:0005768	Component	Endosome	TAS	10851076
GO:0005794	Component	Golgi apparatus	TAS	10851076
GO:0005829	Component	Cytosol	IDA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	8178155
GO:0007165	Process	Signal transduction	TAS	8178155
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IDA	12244150
GO:0007267	Process	Cell-cell signaling	TAS	7759105
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10851076
GO:0016607	Component	Nuclear speck	IDA
GO:0030225	Process	Macrophage differentiation	IDA	24942581
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	9097905, 15123770, 24942581
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042119	Process	Neutrophil activation	IBA
GO:0042119	Process	Neutrophil activation	IDA	15123770
GO:0045062	Process	Extrathymic T cell selection	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048535	Process	Lymph node development	IEA
GO:0050691	Process	Regulation of defense response to virus by host	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	15123770
GO:0050766	Process	Positive regulation of phagocytosis	IDA	15123770
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	27684068

Other IDs

• MIM: 600554
• HGNC: 5977
• e!Ensembl: ENSG00000164136

Protein

• UniProt ID: P40933
• Protein name: Interleukin-15 (IL-15)
• Protein function: Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems (PubMed:15123770). Stimulates the p
• PDB: 2XQB, 2Z3Q, 2Z3R, 4GS7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02372	IL15	33 → 160	Interleukin 15	Domain

• Tissue specificity: TISSUE SPECIFICITY: Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
• Sequence:

  MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
  EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
  SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

• Sequence length: 162

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
TNF signaling pathway
Intestinal immune network for IgA production
Human T-cell leukemia virus 1 infection
Pathways in cancer
Rheumatoid arthritis

Reactome:

Interleukin-15 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	19796965		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21973023, 24434428, 24689757, 24700781, 29528261, 30702754		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28396661		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	22537753		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22158521		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31201235		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19924795, 21049047, 24689757, 24700781, 29528261, 30702754		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	12406087, 30353031, 30373815, 8610139		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	12147628		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25363549		★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	23408864	Associate	★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	23579771		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30193587	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	31772933		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30210445		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	21442636		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	21442636	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31415645		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	30355978, 30806157		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	15749732		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11451753, 19796965, 28923712		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20188418, 20736143, 29440371		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	12860732, 15939793	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10857783, 24086722	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10403280, 10886401, 10976081, 11219394, 12571841, 12878725, 15879699, 16142748, 16507118, 18292234, 18482208, 20736143, 21204897, 22355377, 22792388, 23325887, 25879761, 30718650, 40238799, 9326248	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10688908, 15022319, 18311795, 32246007	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	24086722		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11742275, 15131572, 16629787, 19133918, 26874516, 27081784, 28606589, 29104662, 29486764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	29486764, 30864351	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26136429	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11451753, 19796965, 28923712		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21487524	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	37021483	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31125917		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	18929414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12359737, 15131572, 16614074, 22537753, 23582229, 23637340, 24942692, 26853723, 27899224, 28535470, 28657314, 29699793, 31078730, 31465127, 31570576, 31622625, 31821442		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18378324, 31622625, 32033836, 33932805	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Syndrome Type II, Polyglandular	Polyglandular autoimmune syndrome	BEFREE	22537753		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25692255, 26423796, 27465917, 28574833		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	26136429, 30068596, 30988120		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	17056573	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21334264, 29396044		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21943235		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24953855, 27093372, 30654801		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	28011147	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	27608420		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	10491011, 11080816		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	27994144		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12494899, 20043070, 21394107, 22367420, 25879689, 26141233, 27835865, 27863332, 29582584, 31278126		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23996684, 31278126, 33446741	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	26541527		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	26541527	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	11742275		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	33190987	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14984938, 20086176, 24838092, 30601063		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16041541, 29162948, 29867983	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24953855, 27093372, 30654801		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11022126, 19422685, 19505916, 26742578, 30670085, 30953795		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25827621	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32439797, 39273323	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11499809, 22363690, 26152359, 37541245	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	40612864	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	36410696	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28236454, 30410679		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	17635814		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	18654018	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16109314		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31358322		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32229536	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36159840	Stimulate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	32793194	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28546929		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	10784586, 15357947, 19237603, 20153259, 20166880, 22785229, 23966426, 25298177, 26304964, 28049849, 31622625, 32612145, 34231481	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	BEFREE	11040186, 12949719, 17100768, 17324400, 18435801, 18821940, 19805228, 20153259, 20166880, 21364874, 21938511, 22785229, 23269601, 23966426, 24252355, 24361466, 24942692, 26304964, 26498609, 27648810, 28049849, 28737923, 28738233, 29674648, 30050538, 31494096, 31494097, 31622625, 31839965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	21364874, 24971453, 26001928	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	23269601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	28592627		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29959050		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32960689	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29959050		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	17635814	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17947730, 21049047, 24689757, 24700781, 29528261, 30702754		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38221530	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	29449577		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	27558944	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16391014, 26136429, 30068596, 30988120		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29676596		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21198766	Associate	★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	21355077	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	LHGDN	15770395		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27648810, 31636462		★☆☆☆☆ Found in Text Mining only
Colitis Microscopic	Microscopic colitis	Pubtator	16775121	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22158521, 22674296, 24810637, 31760731		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	14581351, 15943034		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24795032, 26996193, 30026861		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22674296	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39456247	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28639033		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	26136429		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9863005		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19796965, 24603895		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19796965, 24603895, 28923712		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24603895	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19796965, 24603895		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31266741		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	20003352	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23014361		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	30905425		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	30905425	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17289161, 26464654		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30054439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	26874516		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24019554		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11091268	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11359391, 11751999		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	11751999		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	12147628		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	12147628		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32691471	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	11960373		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28729536, 30110639		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33126577	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28729536, 30110639, 31032897		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23638076	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35801423	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18435801, 22537753, 24342660, 26853723, 31127035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18697873, 22322482, 28752527, 28940555, 30029895, 31358322		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	31772933		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22322482		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	18386990		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	33206953	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	30029895		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	11134366		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11359391, 11751999		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31349155		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	22537753		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12571184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	12765345, 12810542, 29477012, 30712043		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enteritis	Enteritis	BEFREE	31831090		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	20381491, 29363170		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	20381491, 28581883, 31352605		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29691386	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24464181		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24464181		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	9180138		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	21943235		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28923712		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10359107		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26836972		★☆☆☆☆ Found in Text Mining only
Food intolerance (disorder)	Food Intolerance	BEFREE	29363170		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	10378426		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	10378426, 27538697	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	35905420	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	29363170		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11079620	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	32043817	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36434955	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	9769118	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	9863005		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30049387, 9863005		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30049387, 30297770		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	26152359	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	18978209, 27927647, 28013013, 28574833		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	21484763	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28164472		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	18821940, 28738233		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	20016049, 28164472		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17635814	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11750110, 28181907		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	27082643	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30353031		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	15749495	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	28751644	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22241125	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	35801423	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	16041541	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	26214693, 34571865	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19593212, 30864351	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16109314		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	19593212	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27129235, 30459756, 32983105	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21309737	Inhibit	★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	22705105		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31622625		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	32033836, 35801423	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20728526, 29222435, 29848756		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10358752, 11742275, 23039249, 26853723, 27648810, 28797042, 31567972, 9609761		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23039249, 28797042	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	10925312, 24019554		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	18821940	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	24361466, 31345839		★☆☆☆☆ Found in Text Mining only
Intrinsic Factor Deficiency	Intrinsic Factor Deficiency	BEFREE	27343564		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	27445342	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27994144, 29959050		★☆☆☆☆ Found in Text Mining only
Keratitis Ichthyosis Deafness Syndrome	Keratitis ichthyosis deafness syndrome	Pubtator	30150638	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19289234	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	10447937		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	31784594, 34571865	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11358383, 21364281, 21973023, 23582229, 25220211, 25736261, 26255115, 27927647, 29431743, 29737430, 31355489, 31570576, 31777543		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18684941, 18852469, 19526239, 19924795, 24489097, 8605349	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22077621	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19526239, 26246143, 26941401	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	21364281, 23153537, 8978293		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26246143, 26675759, 28824651, 29692776		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	21304101, 30353031, 30373815, 8610139		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28495790		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15225634, 18418772, 24721706, 28811965, 29162948, 29737430, 29867983		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	19594300	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26646698	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15225634, 18418772		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11742275		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32691471	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30053975		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22471460, 30953795, 32925168, 33480074	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31040163		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	24500400		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	11168804	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24391825, 24500400, 27412348, 27847409, 31049024, 34936686	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29023581	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	24500400		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24391825, 24500400, 29023581, 30453818, 31049024		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	27716443	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	24500400		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17391312	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11358383, 21973023		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11427729, 20388848, 24162786, 25805565, 26255115, 28291388, 28725044, 30373815		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	29895668		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	10949545, 11359391, 11675351, 16322477, 18281483, 24621498, 27422033, 29180399, 30876800, 9864169		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	15328153		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	LHGDN	17142786		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	21041729, 25692255, 28495790, 29664568		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	28031720		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	8605349	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31018250		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12494899, 20043070, 21394107, 22367420, 25879689, 25997501, 26141233, 27835865, 27863332, 29582584, 31278126		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24464181		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	9863005		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19422685, 19505916, 26742578, 30670085, 30953795		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14984938, 28236454, 30064894, 30410679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10770643, 28915646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10945499, 11310838, 12429727, 24572789, 28379958, 31392791, 31748686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26503216		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24953855, 27093372, 30654801		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10359107, 10424745, 12850791, 16621991, 18418772, 18978209, 21943235, 21956355, 22019703, 22032984, 22447977, 22491823, 23153537, 23157547, 23444943, 24645750, 24838092, 24953855, 25403209, 25736261, 26141233, 27465917, 27474151, 27630154, 28181907, 28286036, 28379958, 28507797, 28637876, 28811289, 28823521, 28842470, 28888485, 29415897, 29636345, 29664568, 29691234, 30212254, 30353031, 30590736, 30621204, 30798123, 31348785, 31392791, 31465127, 31760731, 31821442, 9863005		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22674296, 24810637, 31760731		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26141233		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11064452, 14605763, 23931270, 24000979, 24645750, 26364916, 27474151, 28286036, 28408199, 28424693, 30833178, 7585540, 9605179, 9627116		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17492620, 19501956, 29948616, 34032721, 37334356, 37923822	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26874516		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18514540	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18514540, 28923712		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	20560915		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	11091268	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	23298273		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	23298273	Associate	★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	16105889	Associate	★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	9024273		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10444159, 10627470, 38212320	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10627470, 16734623, 28972539, 29542132, 29691234		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10447940, 9472681	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12098515, 16231285, 25617471		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16231285, 18378324, 21622858	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	10447940	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	12098515		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	26087886, 29699793		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	24621498	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29941459		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27036031, 29941459	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	21967803, 31815824		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31240830	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	26646698	Associate	★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	24577461		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37536937	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	21967803	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10359107, 10424745, 10627470, 10861581, 10945499, 10949545, 10975824, 11493471, 11810184, 12847220, 14605763, 15225634, 16621962, 17100778, 18250415, 18760876, 19200609, 19421751, 19422685, 20428207, 21822803, 21956355, 22032984, 22158521, 22491823, 22565311, 23637340, 23931270, 23996684, 24000979, 24045181, 24572789, 24645750, 24648340, 24657179, 24810637, 24838092, 25108500, 25627006, 25879689, 25997501, 26141233, 26364916, 26503216, 26742578, 26996193, 27380620, 27409425, 27422033, 27776794, 27835865, 27986749, 28181907, 28239463, 28286036, 28379958, 28396661, 28507797, 28651743, 28811289, 29088859, 29162948, 29180399, 29222435, 29224228, 29255466, 29296227, 29311382, 29582584, 29691234, 29867983, 29901436, 30026861, 30214153, 30306093, 30373815, 30452438, 30587590, 30617136, 30670085, 31040163, 31107371, 31292145, 31455682, 31623390, 31741709, 9627116, 9862562		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	22510877		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30617136, 31455682, 31484667		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18240307		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29616032		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	26244337		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22471460, 30670085		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome 1	Noonan Syndrome	BEFREE	22563505		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18697873, 26516848, 28752527, 28923712, 30189147, 30806157, 31358322		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19309557, 20622171	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26516848	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26464654, 32793194	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34209473	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	19289234	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19756346, 21620893		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19756346		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21240486, 23624801	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	9180138		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30410679		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28236454		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23354626	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10770643, 28915646		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37865999	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	30212254		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	31545423		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	11717409, 31402625, 9482906	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	18509087	Stimulate	★☆☆☆☆ Found in Text Mining only
Parapsoriasis	Parapsoriasis	BEFREE	11359391		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27608420		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	10652024	Associate	★☆☆☆☆ Found in Text Mining only
POLYCYSTIC LIPOMEMBRANOUS OSTEODYSPLASIA WITH SCLEROSING LEUKOENCEPHALOPATHY 1	Polycystic Lipomembranous Osteodysplasia With Sclerosing Leukoencephalopathy	BEFREE	30690291		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20236632, 35551681	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	12147628, 27374114		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	12147628		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	26646698	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30999091		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	24700781		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	24700781		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17947730		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21973023, 24689757		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30054439		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29449577		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10945499, 11310838, 12429727, 24572789, 28379958, 31392791, 31748686		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19047106, 21943235, 23754304	Associate	★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	12772186		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	23787026, 28827115		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10925312, 11359391, 11751999, 17554368, 17934500, 18830267, 24019554, 26853723		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	17554368, 18424079, 18580966		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	17554368		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28185567, 40158635	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30702923		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	9949171	Associate	★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30905425		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	28518224		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	28518224	Stimulate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22674296		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9863005		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	30193587	Inhibit	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	26471937		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28659917, 9180138, 9862562		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	9862562	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10358752, 10562301, 10976081, 11086103, 11315916, 11742275, 12165497, 12571841, 15124245, 15879699, 16507118, 17161467, 17289161, 17616399, 18446062, 20007590, 20188418, 20736143, 21620893, 22440823, 23773307, 26853723, 27608420, 29656472, 30233684, 30431436, 30659893		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12165497, 16507118, 17616399		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	30029643		★☆☆☆☆ Found in Text Mining only
Sandhoff Disease	Sandhoff Disease	BEFREE	28385189		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	11742275		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	18654018	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	23624801	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	9180138		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23624801	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28031340, 31201735		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	12435740	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	29939941, 7659163, 8781427, 8916956		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency Autosomal Recessive T Cell Negative B Cell Positive NK Cell Positive	Severe combined immunodeficiency	Pubtator	29867983	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	24621498		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30730588, 31653683		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848, 36881472	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	24621498, 28518224	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10447937, 11168804, 11751999, 15214050, 24621498, 28518224		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10861581, 10975824, 8668345, 9863005		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	10491011, 11080816		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	21442636	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17391312	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31338557		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28923712		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	28411832		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	28011147		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26503216		★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21805152	Stimulate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	28518224		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	16142748	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	17289161		★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	21364281, 23212516, 28031720, 30353031		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10949545, 15475242		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	15710591		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29162948	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26087886, 29699793		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	30565709		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	9024273		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	28411832		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21308409, 24980552, 30294328		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10484006, 23014361, 24415300		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	22322482		★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	23913972	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	21334264		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	40508061	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	21484763	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	31078730		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	31877315	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	31078730		★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	10889304, 12446913, 12857971, 14966353, 7481768, 7632950, 7659163, 7803808, 8605322, 8605323, 8676091, 8781427, 9479568, 9834214, 9921912		★☆☆☆☆ Found in Text Mining only