Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	360
Gene name	Aquaporin 3 (Gill blood group)
Gene symbol	AQP3
Synonyms (NCBI Gene)	AQP-3GIL
Chromosome	9
Chromosome location	9p13.3
Summary	This gene encodes the water channel protein aquaporin 3. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein, also known as aquaporin 0. Aquaporin 3 is localized at the basal lateral membranes of collecting d

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1347380973	C>G,T	Affects	Splice donor variant, intron variant

227

Show/Hide all (227)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040256	hsa-miR-615-3p	CLASH	23622248
MIRT053376	hsa-miR-874-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23800944
MIRT053376	hsa-miR-874-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23800944
MIRT053376	hsa-miR-874-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23800944
MIRT053376	hsa-miR-874-3p	Luciferase reporter assayqRT-PCRWestern blot	24462679
MIRT438336	hsa-miR-185-5p	Luciferase reporter assayWestern blot	24070899
MIRT438336	hsa-miR-185-5p	Luciferase reporter assayWestern blot	24070899
MIRT695357	hsa-miR-548n	HITS-CLIP	23313552
MIRT695356	hsa-miR-548az-5p	HITS-CLIP	23313552
MIRT695355	hsa-miR-548t-5p	HITS-CLIP	23313552
MIRT695354	hsa-miR-548a-5p	HITS-CLIP	23313552
MIRT695353	hsa-miR-548ab	HITS-CLIP	23313552
MIRT695352	hsa-miR-548ad-5p	HITS-CLIP	23313552
MIRT695351	hsa-miR-548ae-5p	HITS-CLIP	23313552
MIRT695350	hsa-miR-548ak	HITS-CLIP	23313552
MIRT695349	hsa-miR-548am-5p	HITS-CLIP	23313552
MIRT695348	hsa-miR-548ap-5p	HITS-CLIP	23313552
MIRT695347	hsa-miR-548aq-5p	HITS-CLIP	23313552
MIRT695346	hsa-miR-548ar-5p	HITS-CLIP	23313552
MIRT695345	hsa-miR-548as-5p	HITS-CLIP	23313552
MIRT695344	hsa-miR-548au-5p	HITS-CLIP	23313552
MIRT695343	hsa-miR-548ay-5p	HITS-CLIP	23313552
MIRT695342	hsa-miR-548b-5p	HITS-CLIP	23313552
MIRT695341	hsa-miR-548bb-5p	HITS-CLIP	23313552
MIRT695340	hsa-miR-548c-5p	HITS-CLIP	23313552
MIRT695339	hsa-miR-548d-5p	HITS-CLIP	23313552
MIRT695338	hsa-miR-548h-5p	HITS-CLIP	23313552
MIRT695337	hsa-miR-548i	HITS-CLIP	23313552
MIRT695336	hsa-miR-548j-5p	HITS-CLIP	23313552
MIRT695335	hsa-miR-548o-5p	HITS-CLIP	23313552
MIRT695334	hsa-miR-548w	HITS-CLIP	23313552
MIRT695333	hsa-miR-548y	HITS-CLIP	23313552
MIRT695332	hsa-miR-559	HITS-CLIP	23313552
MIRT695331	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT695330	hsa-miR-3125	HITS-CLIP	23313552
MIRT695329	hsa-miR-3916	HITS-CLIP	23313552
MIRT695328	hsa-miR-6859-5p	HITS-CLIP	23313552
MIRT695327	hsa-miR-3159	HITS-CLIP	23313552
MIRT695326	hsa-miR-3163	HITS-CLIP	23313552
MIRT695325	hsa-miR-889-3p	HITS-CLIP	23313552
MIRT695324	hsa-miR-877-5p	HITS-CLIP	23313552
MIRT695323	hsa-miR-6869-5p	HITS-CLIP	23313552
MIRT695322	hsa-miR-653-5p	HITS-CLIP	23313552
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT664406	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT664405	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT664404	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT664403	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT626527	hsa-miR-4643	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT695357	hsa-miR-548n	HITS-CLIP	23313552
MIRT695356	hsa-miR-548az-5p	HITS-CLIP	23313552
MIRT695355	hsa-miR-548t-5p	HITS-CLIP	23313552
MIRT695354	hsa-miR-548a-5p	HITS-CLIP	23313552
MIRT695353	hsa-miR-548ab	HITS-CLIP	23313552
MIRT695352	hsa-miR-548ad-5p	HITS-CLIP	23313552
MIRT695351	hsa-miR-548ae-5p	HITS-CLIP	23313552
MIRT695350	hsa-miR-548ak	HITS-CLIP	23313552
MIRT695349	hsa-miR-548am-5p	HITS-CLIP	23313552
MIRT695348	hsa-miR-548ap-5p	HITS-CLIP	23313552
MIRT695347	hsa-miR-548aq-5p	HITS-CLIP	23313552
MIRT695346	hsa-miR-548ar-5p	HITS-CLIP	23313552
MIRT695345	hsa-miR-548as-5p	HITS-CLIP	23313552
MIRT695344	hsa-miR-548au-5p	HITS-CLIP	23313552
MIRT695343	hsa-miR-548ay-5p	HITS-CLIP	23313552
MIRT695342	hsa-miR-548b-5p	HITS-CLIP	23313552
MIRT695341	hsa-miR-548bb-5p	HITS-CLIP	23313552
MIRT695340	hsa-miR-548c-5p	HITS-CLIP	23313552
MIRT695339	hsa-miR-548d-5p	HITS-CLIP	23313552
MIRT695338	hsa-miR-548h-5p	HITS-CLIP	23313552
MIRT695337	hsa-miR-548i	HITS-CLIP	23313552
MIRT695336	hsa-miR-548j-5p	HITS-CLIP	23313552
MIRT695335	hsa-miR-548o-5p	HITS-CLIP	23313552
MIRT695334	hsa-miR-548w	HITS-CLIP	23313552
MIRT695333	hsa-miR-548y	HITS-CLIP	23313552
MIRT695332	hsa-miR-559	HITS-CLIP	23313552
MIRT695331	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT695330	hsa-miR-3125	HITS-CLIP	23313552
MIRT695329	hsa-miR-3916	HITS-CLIP	23313552
MIRT695328	hsa-miR-6859-5p	HITS-CLIP	23313552
MIRT695327	hsa-miR-3159	HITS-CLIP	23313552
MIRT695326	hsa-miR-3163	HITS-CLIP	23313552
MIRT695325	hsa-miR-889-3p	HITS-CLIP	23313552
MIRT695324	hsa-miR-877-5p	HITS-CLIP	23313552
MIRT695323	hsa-miR-6869-5p	HITS-CLIP	23313552
MIRT695322	hsa-miR-653-5p	HITS-CLIP	23313552
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT664406	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT664405	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT664404	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT664403	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT626527	hsa-miR-4643	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT611611	hsa-miR-8485	HITS-CLIP	23824327
MIRT611610	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611609	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT611608	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT611607	hsa-miR-4641	HITS-CLIP	23824327
MIRT611606	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT756398	hsa-miR-551b-3p	Luciferase reporter assayWestern blottingqRT-PCR	37000315
MIRT791492	hsa-miR-1291	CLIP-seq
MIRT791493	hsa-miR-297	CLIP-seq
MIRT791494	hsa-miR-328	CLIP-seq
MIRT791495	hsa-miR-3677-5p	CLIP-seq
MIRT791496	hsa-miR-3689a-3p	CLIP-seq
MIRT791497	hsa-miR-3689c	CLIP-seq
MIRT791498	hsa-miR-3924	CLIP-seq
MIRT791499	hsa-miR-4268	CLIP-seq
MIRT791500	hsa-miR-4448	CLIP-seq
MIRT791501	hsa-miR-4520a-3p	CLIP-seq
MIRT791502	hsa-miR-4520b-3p	CLIP-seq
MIRT791503	hsa-miR-4697-3p	CLIP-seq
MIRT791504	hsa-miR-567	CLIP-seq
MIRT791505	hsa-miR-635	CLIP-seq
MIRT791506	hsa-miR-663b	CLIP-seq
MIRT1933488	hsa-miR-127-3p	CLIP-seq
MIRT791493	hsa-miR-297	CLIP-seq
MIRT1933489	hsa-miR-3156-3p	CLIP-seq
MIRT791498	hsa-miR-3924	CLIP-seq
MIRT791499	hsa-miR-4268	CLIP-seq
MIRT1933490	hsa-miR-4301	CLIP-seq
MIRT1933491	hsa-miR-4432	CLIP-seq
MIRT791500	hsa-miR-4448	CLIP-seq
MIRT1933492	hsa-miR-499-5p	CLIP-seq
MIRT791504	hsa-miR-567	CLIP-seq
MIRT2173555	hsa-miR-4313	CLIP-seq
MIRT2173556	hsa-miR-466	CLIP-seq
MIRT2173557	hsa-miR-4667-3p	CLIP-seq
MIRT2173558	hsa-miR-4672	CLIP-seq
MIRT2173559	hsa-miR-4686	CLIP-seq
MIRT791506	hsa-miR-663b	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CREB1	Unknown	18495115
TP53	Unknown	11231003
TP73	Unknown	11231003

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002684	Process	Positive regulation of immune system process	IDA	17943189
GO:0002931	Process	Response to ischemia	IEA
GO:0003091	Process	Renal water homeostasis	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	18718702, 19545896
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14521551, 18718702, 19545896
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	18718702
GO:0005911	Component	Cell-cell junction	IEA
GO:0006833	Process	Water transport	IBA
GO:0006833	Process	Water transport	IDA	30420639
GO:0006833	Process	Water transport	IEA
GO:0006833	Process	Water transport	TAS	17943189
GO:0015204	Function	Urea transmembrane transporter activity	IBA
GO:0015250	Function	Water channel activity	EXP	9369468, 10510269, 16596446
GO:0015250	Function	Water channel activity	IBA
GO:0015250	Function	Water channel activity	IDA	30420639
GO:0015250	Function	Water channel activity	IEA
GO:0015250	Function	Water channel activity	TAS	17943189
GO:0015254	Function	Glycerol channel activity	IBA
GO:0015254	Function	Glycerol channel activity	IDA	17943189, 30420639
GO:0015254	Function	Glycerol channel activity	IEA
GO:0015267	Function	Channel activity	IEA
GO:0015793	Process	Glycerol transmembrane transport	IBA
GO:0015793	Process	Glycerol transmembrane transport	IDA	30420639
GO:0015793	Process	Glycerol transmembrane transport	IEA
GO:0015840	Process	Urea transport	IEA
GO:0016020	Component	Membrane	IC	17943189
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0032526	Process	Response to retinoic acid	IDA	17943189
GO:0033280	Process	Response to vitamin D	TAS	17943189
GO:0042476	Process	Odontogenesis	IEP	12522663
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0045616	Process	Regulation of keratinocyte differentiation	TAS	17943189
GO:0051592	Process	Response to calcium ion	TAS	17943189
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070295	Process	Renal water absorption	IEA
GO:0071456	Process	Cellular response to hypoxia	IDA	24462679
GO:0071918	Process	Urea transmembrane transport	IEA

MIM	HGNC	e!Ensembl
600170	636	ENSG00000165272

Q92482

Protein name

Aquaporin-3 (AQP-3) (Aquaglyceroporin-3)

Protein function

Aquaglyceroporins form homotetrameric transmembrane channels, with each monomer independently mediating glycerol and water transport across the plasma membrane along their osmotic gradient (PubMed:12239222, PubMed:30420639). Could also be permea

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00230	MIP	16 → 261	Major intrinsic protein	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in epithelial cells of kidney (collecting ducts) and airways, in keratinocytes, immature dendritic cells and erythrocytes. Isoform 2 is not detectable in erythrocytes at the protein level.

Sequence

MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN
LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF
GLYYDAIWHFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVD
PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQ
HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI

Sequence length

292

Interactions

View interactions

	KEGG		Reactome
	Vasopressin-regulated water reabsorption		Vasopressin regulates renal water homeostasis via Aquaporins Passive transport by Aquaporins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AQP3-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIL BLOOD GROUP	Affects	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONGUE NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (148)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Actinic keratosis	Actinic keratosis	BEFREE	28656282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17056099, 31696517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17056099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17056099, 31696517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	22576684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	22576684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	18435676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	18435676		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28377226, 30531392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	22576684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asphyxia	Asphyxia	Pubtator	32627013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	22306368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	28656282	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23468877, 25964557, 26219409, 29963136, 31277235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23017148, 23468877, 26219409, 36077333, 37175840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37681917	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	12556012	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	30515575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24224160, 24260356, 26506416, 32543927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17056099, 18548108, 20106632, 31373900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21400035	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	37713813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	32382899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24224160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	22808259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28189680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21400035	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21401805, 24070899, 28656282, 37584713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	18543247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23017148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37175233, 37334171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	35957833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24260356	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16918518, 18548108, 21191421, 24260356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16918518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21191421, 24260356, 28526298, 28813533, 30515575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32627013	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28546424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36038817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	31373900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16918518, 21191421, 24260356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	25725905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27487831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	30768374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21401805		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	21401805	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21401805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	30540703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26506416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	36038817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	25766885, 27774749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21289260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	26207951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	34745849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26765123, 33917751, 37713813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	26896765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28258570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21502813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	25299207, 35437455, 39962475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26820815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	30531392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28525373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	31033595	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21401805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24224160, 27022216, 28258570, 29415990, 31197130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31696517, 32521874, 33099905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	20177751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	21401805		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21401805, 37334171	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24918928	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	30110699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23468877, 25964557, 26219409, 29963136, 31277235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21401805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28189680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21401805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	18214481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28107421, 28377226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19513079, 25515250, 29532894, 30176851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	21401805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	24260356, 31305898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23800944, 26506416, 28620264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	CTD_human_DG	21401805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	22576684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	22306368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21401805, 23800944, 28991174, 29532894, 30015825, 30176851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	31305898		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22130551, 31305898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22130551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	34745849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25450461, 26794461, 30110699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17056099, 17967887, 18548108, 20106632, 20364107, 21401805, 22808259, 24022233, 24224160, 24260356, 24803527, 25964557, 28189680, 28377226, 28471475 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	10737773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25299207, 39962475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24803527, 26765123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	21502813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26219409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30015825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30015825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	26810286		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	18214481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29472315	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28107421, 28377226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28471475, 30531392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28107421, 37761834, 40305202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18543247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	18543247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	23041062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30768374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30768374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19513079, 25515250, 29532894, 30176851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18036046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19513079, 30176851, 33917751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26100668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	32075009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30025158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29449936, 31582652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29925705, 33603736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	21400035, 24260356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	17967887, 28991174, 31305898		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	21401805		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	24260356, 34745849	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	21401805, 28656282, 31373900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21401805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23797770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31373900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	17967887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20364107, 23152856, 23800944, 26506416, 26918728, 28620264, 28968998, 29563612, 30110699, 31220652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	23152856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	29678898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20364107, 21943213, 24887009, 26506416, 26768614, 32543927, 33993193, 35957833, 36181978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31220652	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweat Gland Neoplasms	Sweat gland neoplasm	Pubtator	34745849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28732436, 30536805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	22808259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22808259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22808259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	22808259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	CTD_human_DG	21401805		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30013662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35672711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	22808259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22306368, 23043286	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	24022233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22901156, 24918928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Uterine Cervicitis	BEFREE	22901156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	20428189, 26923934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	20428189	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	20428189, 26923934		★★★★★ ★☆☆☆☆ Found in Text Mining only

AQP3 (aquaporin 3 (Gill blood group))