IL12RB2 (interleukin 12 receptor subunit beta 2)

Gene

• Entrez ID: 3595
• Gene name: Interleukin 12 receptor subunit beta 2
• Gene symbol: IL12RB2
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1p31.3
• Summary: The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and rec

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025732	hsa-miR-7-5p	Microarray	17612493
MIRT039597	hsa-miR-625-5p	CLASH	23622248
MIRT621069	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT621068	hsa-miR-3122	HITS-CLIP	23824327
MIRT621067	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT621066	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT621065	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT621064	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT531932	hsa-miR-200a-5p	PAR-CLIP	22012620
MIRT531931	hsa-miR-200b-5p	PAR-CLIP	22012620
MIRT531930	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT531929	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT531928	hsa-miR-493-5p	PAR-CLIP	22012620
MIRT531927	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT621069	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT621068	hsa-miR-3122	HITS-CLIP	23824327
MIRT621067	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT621066	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT621065	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT621064	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT531932	hsa-miR-200a-5p	PAR-CLIP	22012620
MIRT531931	hsa-miR-200b-5p	PAR-CLIP	22012620
MIRT531930	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT531929	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT531928	hsa-miR-493-5p	PAR-CLIP	22012620
MIRT531927	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT2015041	hsa-miR-101	CLIP-seq
MIRT2015042	hsa-miR-144	CLIP-seq
MIRT2247372	hsa-miR-3200-5p	CLIP-seq
MIRT2247373	hsa-miR-4682	CLIP-seq
MIRT2247374	hsa-miR-4765	CLIP-seq
MIRT2389322	hsa-let-7a	CLIP-seq
MIRT2389323	hsa-let-7b	CLIP-seq
MIRT2389324	hsa-let-7c	CLIP-seq
MIRT2389325	hsa-let-7d	CLIP-seq
MIRT2389326	hsa-let-7e	CLIP-seq
MIRT2389327	hsa-let-7f	CLIP-seq
MIRT2389328	hsa-let-7g	CLIP-seq
MIRT2389329	hsa-let-7i	CLIP-seq
MIRT2389330	hsa-miR-3927	CLIP-seq
MIRT2389331	hsa-miR-4458	CLIP-seq
MIRT2389332	hsa-miR-4500	CLIP-seq
MIRT2389333	hsa-miR-4650-3p	CLIP-seq
MIRT2389334	hsa-miR-4773	CLIP-seq
MIRT2389335	hsa-miR-587	CLIP-seq
MIRT2389336	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA3	Repression	21632975

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004896	Function	Cytokine receptor activity	TAS	8943050
GO:0005886	Component	Plasma membrane	IC	8943050
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8943050
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	8943050
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8943050
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0015026	Function	Coreceptor activity	IDA	8943050
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019955	Function	Cytokine binding	IBA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11114383
GO:0034097	Process	Response to cytokine	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7528775, 7638186
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	8943050
GO:0043235	Component	Receptor complex	IBA
GO:0045063	Process	T-helper 1 cell differentiation	IDA	14688310

Other IDs

• MIM: 601642
• HGNC: 5972
• e!Ensembl: ENSG00000081985

Protein

• UniProt ID: Q99665
• Protein name: Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
• Protein function: Receptor for interleukin-12. This subunit is the signaling component coupling to the JAK2/STAT4 pathway. Promotes the proliferation of T-cells as well as NK cells. Induces the promotion of T-cells towards the Th1 phenotype by strongly enhancing
• PDB: 8XRP, 8YI7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06328	Lep_receptor_Ig	28 → 110	Ig-like C2-type domain	Domain
  PF00041	fn3	422 → 511	Fibronectin type III domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 2 is expressed at similar levels in both naive and activated T-cells. {ECO:0000269|PubMed:9120388}.
• Sequence:

  MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCF
  HYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFV
  GVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDY
  LDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVS
  RCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHL
  YKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHY
  QVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG
  LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYN
  VSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILIS
  WNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTA
  LTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ
  WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRH
  PPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPE
  NPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL
  TFSCGDKLTLDQLKMRCDSLML

• Sequence length: 862

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Pathways in cancer
Inflammatory bowel disease

Reactome:

Interleukin-35 Signalling
Interleukin-12 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL12RB2-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19582164, 26547104		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	LHGDN	18353079		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	24997981		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26916345, 28381868		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	19473523		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19473523, 29794786	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24641287	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	Pubtator	27396555	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34149710, 9120388	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	20622878, 20622879, 22197900, 22378604, 24859272, 25940109, 26097239, 27464962, 27660093, 29017598		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	22378604, 24859272, 29017598	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	GWASCAT_DG	19458352, 20639880, 21399635		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	LHGDN	11940489		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19582164		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29103744, 30355949		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	23152861		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18474725		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	18353079		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	14616794	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17682002, 19235914, 23071489	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23071489		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	39586377	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	18927311		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	LHGDN	18927311		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	17179689	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	20060272		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15667574	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23152861	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	23152861		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27396555	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20060272		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21285166		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25430993	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29446854		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	30355949	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	11441083, 15976343	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	15976343, 24486579		★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	15976343	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36518627	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	19458352, 23152861, 24375552, 25690649, 28299343	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34149710, 34952359	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	19838195, 26502338, 28714469, 30573655		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25720506		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19359411	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29103744, 30355949		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25467645		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19720917, 29073075		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18927311		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18474725		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	18474725		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	11238569, 22182694	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22182694		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	26439963		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29576322		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	GWASCAT_DG	30573655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	18474725, 29103744		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19582164, 23677568, 29956791		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	15572854	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	16946717	Inhibit	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	18353079		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18353079		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	19458352, 23152861, 28299343, 30119881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	19458352, 20639880, 21399635, 22961000, 26394269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	19458352, 20639880, 21399635, 22936693, 22961000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37108754	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18369459, 18650833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35923356	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29247146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30573655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	18369459		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26916345	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25475780, 39282247	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25467645		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22076442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASDB_DG	23740937		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASCAT_DG	29293537, 30573655, 31672989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Takayasu Arteritis	Takayasu Arteritis	BEFREE	26987707		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23280621	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	24859272		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	24859272	Associate	★☆☆☆☆ Found in Text Mining only