Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3589
Gene name	Interleukin 11
Gene symbol	IL11
Synonyms (NCBI Gene)	AGIFIL-11
Chromosome	19
Chromosome location	19q13.42
Summary	The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cy

274

Show/Hide all (274)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005829	hsa-miR-204-5p	ELISAMicroarray	21282569
MIRT005829	hsa-miR-204-5p	Luciferase reporter assay	22629385
MIRT007023	hsa-miR-211-5p	Luciferase reporter assay	22629385
MIRT007025	hsa-miR-379-5p	Luciferase reporter assay	22629385
MIRT022448	hsa-miR-124-3p	Microarray	18668037
MIRT023653	hsa-miR-1-3p	Microarray	18668037
0	hsa-miR-30c-5p	ImmunofluorescenceLuciferase reporter assayWestern blotqRT-PCR	23340433
MIRT053027	hsa-miR-30c-5p	ImmunofluorescenceLuciferase reporter assayWestern blotqRT-PCR	23340433
MIRT007023	hsa-miR-211-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24039954
MIRT023653	hsa-miR-1-3p	Western blot	28186993
MIRT005829	hsa-miR-204-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	31544245
MIRT1063545	hsa-miR-106a	CLIP-seq
MIRT1063546	hsa-miR-106b	CLIP-seq
MIRT1063547	hsa-miR-10a	CLIP-seq
MIRT1063548	hsa-miR-10b	CLIP-seq
MIRT1063549	hsa-miR-1273e	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063551	hsa-miR-17	CLIP-seq
MIRT1063552	hsa-miR-1827	CLIP-seq
MIRT1063553	hsa-miR-192	CLIP-seq
MIRT1063554	hsa-miR-20a	CLIP-seq
MIRT1063555	hsa-miR-20b	CLIP-seq
MIRT1063556	hsa-miR-215	CLIP-seq
MIRT1063557	hsa-miR-2964a-3p	CLIP-seq
MIRT1063558	hsa-miR-302f	CLIP-seq
MIRT1063559	hsa-miR-3122	CLIP-seq
MIRT1063560	hsa-miR-3135	CLIP-seq
MIRT1063561	hsa-miR-3152-5p	CLIP-seq
MIRT1063562	hsa-miR-3200-3p	CLIP-seq
MIRT1063563	hsa-miR-339-5p	CLIP-seq
MIRT1063564	hsa-miR-3622a-3p	CLIP-seq
MIRT1063565	hsa-miR-3622b-3p	CLIP-seq
MIRT1063566	hsa-miR-3689a-3p	CLIP-seq
MIRT1063567	hsa-miR-3689c	CLIP-seq
MIRT1063568	hsa-miR-3689d	CLIP-seq
MIRT1063569	hsa-miR-3913-5p	CLIP-seq
MIRT1063570	hsa-miR-3926	CLIP-seq
MIRT1063571	hsa-miR-4330	CLIP-seq
MIRT1063572	hsa-miR-4421	CLIP-seq
MIRT1063573	hsa-miR-4433	CLIP-seq
MIRT1063574	hsa-miR-4459	CLIP-seq
MIRT1063575	hsa-miR-4684-5p	CLIP-seq
MIRT1063576	hsa-miR-4722-5p	CLIP-seq
MIRT1063577	hsa-miR-4728-5p	CLIP-seq
MIRT1063578	hsa-miR-4755-3p	CLIP-seq
MIRT1063579	hsa-miR-4768-3p	CLIP-seq
MIRT1063580	hsa-miR-4793-3p	CLIP-seq
MIRT1063581	hsa-miR-508-5p	CLIP-seq
MIRT1063582	hsa-miR-519d	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063585	hsa-miR-544b	CLIP-seq
MIRT1063586	hsa-miR-548s	CLIP-seq
MIRT1063587	hsa-miR-593	CLIP-seq
MIRT1063588	hsa-miR-766	CLIP-seq
MIRT1063589	hsa-miR-93	CLIP-seq
MIRT1063590	hsa-miR-940	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063545	hsa-miR-106a	CLIP-seq
MIRT1063546	hsa-miR-106b	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063551	hsa-miR-17	CLIP-seq
MIRT1063554	hsa-miR-20a	CLIP-seq
MIRT1063555	hsa-miR-20b	CLIP-seq
MIRT1063582	hsa-miR-519d	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063589	hsa-miR-93	CLIP-seq
MIRT1063545	hsa-miR-106a	CLIP-seq
MIRT1063546	hsa-miR-106b	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063551	hsa-miR-17	CLIP-seq
MIRT1063554	hsa-miR-20a	CLIP-seq
MIRT1063555	hsa-miR-20b	CLIP-seq
MIRT1063582	hsa-miR-519d	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063589	hsa-miR-93	CLIP-seq
MIRT1063545	hsa-miR-106a	CLIP-seq
MIRT1063546	hsa-miR-106b	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063551	hsa-miR-17	CLIP-seq
MIRT1063554	hsa-miR-20a	CLIP-seq
MIRT1063555	hsa-miR-20b	CLIP-seq
MIRT1063582	hsa-miR-519d	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063589	hsa-miR-93	CLIP-seq
MIRT1063545	hsa-miR-106a	CLIP-seq
MIRT1063546	hsa-miR-106b	CLIP-seq
MIRT1063549	hsa-miR-1273e	CLIP-seq
MIRT2015019	hsa-miR-1289	CLIP-seq
MIRT2015020	hsa-miR-1324	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063551	hsa-miR-17	CLIP-seq
MIRT1063552	hsa-miR-1827	CLIP-seq
MIRT1063554	hsa-miR-20a	CLIP-seq
MIRT1063555	hsa-miR-20b	CLIP-seq
MIRT1063557	hsa-miR-2964a-3p	CLIP-seq
MIRT1063558	hsa-miR-302f	CLIP-seq
MIRT1063559	hsa-miR-3122	CLIP-seq
MIRT1063560	hsa-miR-3135	CLIP-seq
MIRT1063564	hsa-miR-3622a-3p	CLIP-seq
MIRT1063565	hsa-miR-3622b-3p	CLIP-seq
MIRT1063566	hsa-miR-3689a-3p	CLIP-seq
MIRT1063567	hsa-miR-3689c	CLIP-seq
MIRT1063568	hsa-miR-3689d	CLIP-seq
MIRT1063569	hsa-miR-3913-5p	CLIP-seq
MIRT1063573	hsa-miR-4433	CLIP-seq
MIRT1063574	hsa-miR-4459	CLIP-seq
MIRT1063576	hsa-miR-4722-5p	CLIP-seq
MIRT1063577	hsa-miR-4728-5p	CLIP-seq
MIRT1063578	hsa-miR-4755-3p	CLIP-seq
MIRT1063579	hsa-miR-4768-3p	CLIP-seq
MIRT1063580	hsa-miR-4793-3p	CLIP-seq
MIRT1063581	hsa-miR-508-5p	CLIP-seq
MIRT1063582	hsa-miR-519d	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063585	hsa-miR-544b	CLIP-seq
MIRT1063587	hsa-miR-593	CLIP-seq
MIRT2015021	hsa-miR-665	CLIP-seq
MIRT1063588	hsa-miR-766	CLIP-seq
MIRT1063589	hsa-miR-93	CLIP-seq
MIRT1063590	hsa-miR-940	CLIP-seq
MIRT1063545	hsa-miR-106a	CLIP-seq
MIRT1063546	hsa-miR-106b	CLIP-seq
MIRT1063549	hsa-miR-1273e	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063551	hsa-miR-17	CLIP-seq
MIRT1063552	hsa-miR-1827	CLIP-seq
MIRT1063554	hsa-miR-20a	CLIP-seq
MIRT1063555	hsa-miR-20b	CLIP-seq
MIRT1063557	hsa-miR-2964a-3p	CLIP-seq
MIRT1063558	hsa-miR-302f	CLIP-seq
MIRT2247347	hsa-miR-3119	CLIP-seq
MIRT1063559	hsa-miR-3122	CLIP-seq
MIRT1063560	hsa-miR-3135	CLIP-seq
MIRT2247348	hsa-miR-3610	CLIP-seq
MIRT1063564	hsa-miR-3622a-3p	CLIP-seq
MIRT1063565	hsa-miR-3622b-3p	CLIP-seq
MIRT1063566	hsa-miR-3689a-3p	CLIP-seq
MIRT1063567	hsa-miR-3689c	CLIP-seq
MIRT1063568	hsa-miR-3689d	CLIP-seq
MIRT1063569	hsa-miR-3913-5p	CLIP-seq
MIRT1063570	hsa-miR-3926	CLIP-seq
MIRT2247349	hsa-miR-3929	CLIP-seq
MIRT2247350	hsa-miR-4419b	CLIP-seq
MIRT1063573	hsa-miR-4433	CLIP-seq
MIRT1063574	hsa-miR-4459	CLIP-seq
MIRT2247351	hsa-miR-4478	CLIP-seq
MIRT2247352	hsa-miR-4649-3p	CLIP-seq
MIRT1063576	hsa-miR-4722-5p	CLIP-seq
MIRT1063577	hsa-miR-4728-5p	CLIP-seq
MIRT1063579	hsa-miR-4768-3p	CLIP-seq
MIRT1063580	hsa-miR-4793-3p	CLIP-seq
MIRT2247353	hsa-miR-485-5p	CLIP-seq
MIRT1063581	hsa-miR-508-5p	CLIP-seq
MIRT1063582	hsa-miR-519d	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063585	hsa-miR-544b	CLIP-seq
MIRT1063586	hsa-miR-548s	CLIP-seq
MIRT1063588	hsa-miR-766	CLIP-seq
MIRT1063589	hsa-miR-93	CLIP-seq
MIRT1063590	hsa-miR-940	CLIP-seq
MIRT1063545	hsa-miR-106a	CLIP-seq
MIRT1063546	hsa-miR-106b	CLIP-seq
MIRT1063549	hsa-miR-1273e	CLIP-seq
MIRT1063550	hsa-miR-150	CLIP-seq
MIRT1063551	hsa-miR-17	CLIP-seq
MIRT1063552	hsa-miR-1827	CLIP-seq
MIRT1063554	hsa-miR-20a	CLIP-seq
MIRT1063555	hsa-miR-20b	CLIP-seq
MIRT1063557	hsa-miR-2964a-3p	CLIP-seq
MIRT1063558	hsa-miR-302f	CLIP-seq
MIRT1063560	hsa-miR-3135	CLIP-seq
MIRT1063561	hsa-miR-3152-5p	CLIP-seq
MIRT1063564	hsa-miR-3622a-3p	CLIP-seq
MIRT1063565	hsa-miR-3622b-3p	CLIP-seq
MIRT1063568	hsa-miR-3689d	CLIP-seq
MIRT2247349	hsa-miR-3929	CLIP-seq
MIRT2247350	hsa-miR-4419b	CLIP-seq
MIRT1063573	hsa-miR-4433	CLIP-seq
MIRT1063574	hsa-miR-4459	CLIP-seq
MIRT2247351	hsa-miR-4478	CLIP-seq
MIRT2247352	hsa-miR-4649-3p	CLIP-seq
MIRT1063576	hsa-miR-4722-5p	CLIP-seq
MIRT1063579	hsa-miR-4768-3p	CLIP-seq
MIRT1063580	hsa-miR-4793-3p	CLIP-seq
MIRT2247353	hsa-miR-485-5p	CLIP-seq
MIRT1063581	hsa-miR-508-5p	CLIP-seq
MIRT1063582	hsa-miR-519d	CLIP-seq
MIRT1063583	hsa-miR-520g	CLIP-seq
MIRT1063584	hsa-miR-520h	CLIP-seq
MIRT1063585	hsa-miR-544b	CLIP-seq
MIRT1063588	hsa-miR-766	CLIP-seq
MIRT1063589	hsa-miR-93	CLIP-seq
MIRT1063590	hsa-miR-940	CLIP-seq
MIRT2451696	hsa-miR-1228	CLIP-seq
MIRT1063552	hsa-miR-1827	CLIP-seq
MIRT1063559	hsa-miR-3122	CLIP-seq
MIRT1063560	hsa-miR-3135	CLIP-seq
MIRT2451697	hsa-miR-3613-3p	CLIP-seq
MIRT1063566	hsa-miR-3689a-3p	CLIP-seq
MIRT1063567	hsa-miR-3689c	CLIP-seq
MIRT2451698	hsa-miR-371-5p	CLIP-seq
MIRT2451699	hsa-miR-371b-5p	CLIP-seq
MIRT1063569	hsa-miR-3913-5p	CLIP-seq
MIRT1063574	hsa-miR-4459	CLIP-seq
MIRT1063576	hsa-miR-4722-5p	CLIP-seq
MIRT1063577	hsa-miR-4728-5p	CLIP-seq
MIRT1063580	hsa-miR-4793-3p	CLIP-seq
MIRT2451700	hsa-miR-495	CLIP-seq
MIRT1063581	hsa-miR-508-5p	CLIP-seq
MIRT1063588	hsa-miR-766	CLIP-seq
MIRT1063590	hsa-miR-940	CLIP-seq
MIRT2451696	hsa-miR-1228	CLIP-seq
MIRT1063549	hsa-miR-1273e	CLIP-seq
MIRT1063552	hsa-miR-1827	CLIP-seq
MIRT1063557	hsa-miR-2964a-3p	CLIP-seq
MIRT1063558	hsa-miR-302f	CLIP-seq
MIRT1063559	hsa-miR-3122	CLIP-seq
MIRT1063560	hsa-miR-3135	CLIP-seq
MIRT2451697	hsa-miR-3613-3p	CLIP-seq
MIRT1063564	hsa-miR-3622a-3p	CLIP-seq
MIRT1063565	hsa-miR-3622b-3p	CLIP-seq
MIRT1063566	hsa-miR-3689a-3p	CLIP-seq
MIRT1063567	hsa-miR-3689c	CLIP-seq
MIRT1063568	hsa-miR-3689d	CLIP-seq
MIRT2451698	hsa-miR-371-5p	CLIP-seq
MIRT2451699	hsa-miR-371b-5p	CLIP-seq
MIRT1063569	hsa-miR-3913-5p	CLIP-seq
MIRT1063574	hsa-miR-4459	CLIP-seq
MIRT2550758	hsa-miR-4497	CLIP-seq
MIRT1063576	hsa-miR-4722-5p	CLIP-seq
MIRT1063577	hsa-miR-4728-5p	CLIP-seq
MIRT1063579	hsa-miR-4768-3p	CLIP-seq
MIRT1063580	hsa-miR-4793-3p	CLIP-seq
MIRT1063581	hsa-miR-508-5p	CLIP-seq
MIRT1063585	hsa-miR-544b	CLIP-seq
MIRT1063588	hsa-miR-766	CLIP-seq
MIRT1063590	hsa-miR-940	CLIP-seq
MIRT2451696	hsa-miR-1228	CLIP-seq
MIRT1063549	hsa-miR-1273e	CLIP-seq
MIRT1063552	hsa-miR-1827	CLIP-seq
MIRT1063557	hsa-miR-2964a-3p	CLIP-seq
MIRT1063558	hsa-miR-302f	CLIP-seq
MIRT1063559	hsa-miR-3122	CLIP-seq
MIRT1063560	hsa-miR-3135	CLIP-seq
MIRT2451697	hsa-miR-3613-3p	CLIP-seq
MIRT1063564	hsa-miR-3622a-3p	CLIP-seq
MIRT1063565	hsa-miR-3622b-3p	CLIP-seq
MIRT1063566	hsa-miR-3689a-3p	CLIP-seq
MIRT1063567	hsa-miR-3689c	CLIP-seq
MIRT1063568	hsa-miR-3689d	CLIP-seq
MIRT2451698	hsa-miR-371-5p	CLIP-seq
MIRT2451699	hsa-miR-371b-5p	CLIP-seq
MIRT1063569	hsa-miR-3913-5p	CLIP-seq
MIRT1063573	hsa-miR-4433	CLIP-seq
MIRT1063574	hsa-miR-4459	CLIP-seq
MIRT2550758	hsa-miR-4497	CLIP-seq
MIRT2682725	hsa-miR-4667-3p	CLIP-seq
MIRT1063576	hsa-miR-4722-5p	CLIP-seq
MIRT1063577	hsa-miR-4728-5p	CLIP-seq
MIRT1063579	hsa-miR-4768-3p	CLIP-seq
MIRT1063580	hsa-miR-4793-3p	CLIP-seq
MIRT2451700	hsa-miR-495	CLIP-seq
MIRT1063581	hsa-miR-508-5p	CLIP-seq
MIRT1063585	hsa-miR-544b	CLIP-seq
MIRT1063588	hsa-miR-766	CLIP-seq
MIRT1063590	hsa-miR-940	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
HOXA10	Repression	20478621
STAT3	Unknown	23224145

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	33397952
GO:0005125	Function	Cytokine activity	IEA
GO:0005142	Function	Interleukin-11 receptor binding	IEA
GO:0005142	Function	Interleukin-11 receptor binding	NAS	2145578
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 26551460, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	33397952
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	2145578
GO:0008083	Function	Growth factor activity	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2145578
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0030183	Process	B cell differentiation	NAS	2145578
GO:0030219	Process	Megakaryocyte differentiation	NAS	2145578
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IDA	33397952
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0045444	Process	Fat cell differentiation	NAS	1828438
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917
GO:0046888	Process	Negative regulation of hormone secretion	IDA	7867561
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917
GO:1903659	Process	Regulation of complement-dependent cytotoxicity	IMP	16034134
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	16034134

MIM	HGNC	e!Ensembl
147681	5966	ENSG00000095752

P20809

Protein name

Interleukin-11 (IL-11) (Adipogenesis inhibitory factor) (AGIF) (Oprelvekin)

Protein function

Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:2145578). Also promotes the proliferation of hepato

PDB

4MHL , 6O4O , 8DPS , 8DPT , 8DPU , 8DPV , 8DPW , 8QY4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07400	IL11	26 → 199	Interleukin 11	Domain

Sequence

MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL

Sequence length

199

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Hematopoietic cell lineage Rheumatoid arthritis		IL-6-type cytokine receptor ligand interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CYSTITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE IDIOPATHIC SKELETAL HYPEROSTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS OF HIP	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (209)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	30817088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	7670098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	31222870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28861713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	15307108, 7670098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	LHGDN	15307108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16964382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17724739, 20008143, 27524264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16002475, 27524264, 27922075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27487122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	29217821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10407498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29327326, 9952389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10632674, 10926858, 22355377, 29327326, 39879889, 9566801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10669841, 11590369, 11734470, 8613544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12079505, 19251839, 26876177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10407498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	35273577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11699207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31161935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	22629385, 25808168, 28143986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	25808168, 31283912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	37626330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	34360848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16614887, 21099351, 23224145, 23340433, 23813018, 26559373, 28714957, 29343249, 30181697, 30578411, 31040267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20126581, 21099351, 22629385, 28143986, 34841688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchospasm	Bronchospasm	BEFREE	8613544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26876177, 30660488, 30736824, 30954889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21665914, 23307318, 28230858, 29901200, 32815653, 37926706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25702890, 40612864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29555322, 30728748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	BEFREE	9952389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	8808281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	36261332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31096144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36875689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31096144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	22644863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	19716605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	31502734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	30728748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11699207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15004839, 27524264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical galactosemia	Galactosemia	BEFREE	25008910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	10950118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24197332, 31348891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29914371	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16482637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26964871, 30736824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16482637, 30736824, 31754344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	30426460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30728748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27384883, 29100303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	27173233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	37994264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	21442077		★★★★★ ★☆☆☆☆ Found in Text Mining only
CRANIOSYNOSTOSIS AND DENTAL ANOMALIES	Craniosynostosis And Dental Anomalies	GENOMICS_ENGLAND_DG	21741611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10210767, 12486609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	CTD_human_DG	17980069		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	10632674, 29327326, 30197757, 30374069, 30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	21862019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	23818742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	15869869	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37480086	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29555322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	32269565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	20008143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26846819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20008143, 20553623, 31299894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32219408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	8550748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	31831090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	33468134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	10925310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30954889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30954889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30954889	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31078624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	BEFREE	25008910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30086773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30086773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	12679933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18431520, 30383471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	27173233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	27173233, 30520693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	24434062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	LHGDN	15025215, 18433382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26506879, 36834778, 7501271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	7501271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	7501271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35273577	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30728748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30728748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	18680527	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26172388, 30056070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	33468134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis Diffuse Idiopathic Skeletal	Diffuse idiopathic skeletal hyperostosis	Pubtator	37156767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	11517162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	31840157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31840157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23307318, 27487122	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32720740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	12819039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	12819039, 31216486, 37545510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31216486, 31554736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	28352325, 29704458, 31008943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	25257527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	15613426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10950118, 12486609, 17948929, 9881950		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31624329, 8427997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32855274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	8453105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29787432, 8401258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21665914, 23307318, 29901200, 31375423, 31439713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	9566801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31216486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37266432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26876177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34142593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	28861713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	24002086		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	24002086		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Hypertension	Malignant Hypertension	BEFREE	31840157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16614887, 21099351, 22120474, 22211709, 23224145, 23340433, 23813018, 26559373, 28714957, 29343249, 30181697, 30578411, 31040267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26846819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30954889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30086773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	23948300, 30885958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11161848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14744752, 23549086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17724739, 19121317, 22393310, 23948300, 27173233, 28160627, 29690750, 29709516, 30383471, 30520693, 31273847, 31686851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11161848, 18941632, 21665914, 21995459, 23027619, 23153532, 24297922, 25808168, 26846819, 27487122, 28707573, 28714957, 29361454, 29709516, 31161823, 31735169, 8401258 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11410329, 23340433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16614887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	35159191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	7648448, 9488033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	14744752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	25257527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11122145, 15377473, 22289923, 31283912, 8916964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11122145, 18512025, 8145045, 8549788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11311337, 19734214, 23818742, 31140860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30149119, 31341075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	7670098, 8104229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22707562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	11479840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	11479840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11375124, 11410329, 14600590, 16002475, 16614887, 19121317, 20008143, 21982075, 22457856, 22992748, 23549086, 24980816, 25929737, 26964871, 28098860 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	11675407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	7501271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29787432, 8401258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29550807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongranulomatous uveitis	Nongranulomatous uveitis	BEFREE	31161935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10632674, 25575966, 30664745, 33055079, 33258547, 39879889	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	10703936	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	30374069		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30374069, 30664745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	CTD_human_DG	30374069, 30664745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteolysis	Osteolysis	Pubtator	10975922, 22629385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10467228, 11196664, 12384500, 9738508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	BEFREE	12384500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28321811, 28698375, 7670098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	15307108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	LHGDN	15307108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	Pubtator	15307108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	31329230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29662190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23027619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	29217821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21982075		★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	31502734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	10926858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	15025215, 18433382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	29202476		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31403827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31554782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35551681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17713553, 21042281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	17713553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28861713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31403827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11141475, 14744752, 23549086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26528857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27524264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	10925310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31554736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation Syndrome	Radiation Syndrome	BEFREE	29787432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27384883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29160304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	27297950	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10632674, 29327326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	31161935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	31840157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	23317891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30954889, 31544245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31078624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17724739, 19121317, 22393310, 27173233, 28160627, 29690750, 29709516, 30383471, 30520693, 31273847, 31686851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22393310, 22457856, 25929737, 27173233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	28960674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31502734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	LHGDN	15121272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	18941632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30661062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27487122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12486609, 29914371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	12486609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	24002086		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30660488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Disease	von Willebrand disorder	BEFREE	18680527, 21833452, 23238591		★★★★★ ★☆☆☆☆ Found in Text Mining only

IL11 (interleukin 11)