Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3588
Gene name	Interleukin 10 receptor subunit beta
Gene symbol	IL10RB
Synonyms (NCBI Gene)	CDW210BCRF2-4CRFB4D21S58D21S66IBD25IL-10R2IL-10RB
Chromosome	21
Chromosome location	21q22.11
Summary	The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal tra

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2834167	A>G,T	Benign, risk-factor	Missense variant, coding sequence variant, stop gained
rs45545138	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs121909601	G>A	Pathogenic	Coding sequence variant, stop gained
rs387907326	G>A,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs778708008	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1329427406	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1373354533	G>A	Pathogenic	Stop gained, coding sequence variant

219

Show/Hide all (219)

miRTarBase ID	miRNA	Experiments	Reference
MIRT679405	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT620783	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT679404	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT679403	hsa-miR-4770	HITS-CLIP	23824327
MIRT679402	hsa-miR-6088	HITS-CLIP	23824327
MIRT679401	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT679400	hsa-miR-1273f	HITS-CLIP	23824327
MIRT679399	hsa-miR-4534	HITS-CLIP	23824327
MIRT679398	hsa-miR-8082	HITS-CLIP	23824327
MIRT679397	hsa-miR-1289	HITS-CLIP	23824327
MIRT679396	hsa-miR-4294	HITS-CLIP	23824327
MIRT679395	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT679394	hsa-miR-3198	HITS-CLIP	23824327
MIRT679393	hsa-miR-4309	HITS-CLIP	23824327
MIRT679392	hsa-miR-8055	HITS-CLIP	23824327
MIRT679391	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT620786	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT648717	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648716	hsa-miR-4532	HITS-CLIP	23824327
MIRT620785	hsa-miR-5193	HITS-CLIP	23824327
MIRT620784	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT648715	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT620783	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648714	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT648713	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT620782	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT648712	hsa-miR-4284	HITS-CLIP	23824327
MIRT620781	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT620786	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT620785	hsa-miR-5193	HITS-CLIP	23824327
MIRT620784	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT620783	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT620782	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT620781	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT679400	hsa-miR-1273f	HITS-CLIP	27418678
MIRT679397	hsa-miR-1289	HITS-CLIP	27418678
MIRT679391	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT620783	hsa-miR-1304-3p	HITS-CLIP	27418678
MIRT679404	hsa-miR-143-3p	HITS-CLIP	27418678
MIRT679394	hsa-miR-3198	HITS-CLIP	27418678
MIRT679396	hsa-miR-4294	HITS-CLIP	27418678
MIRT679393	hsa-miR-4309	HITS-CLIP	27418678
MIRT679399	hsa-miR-4534	HITS-CLIP	27418678
MIRT679401	hsa-miR-4708-5p	HITS-CLIP	27418678
MIRT679403	hsa-miR-4770	HITS-CLIP	27418678
MIRT679402	hsa-miR-6088	HITS-CLIP	27418678
MIRT679405	hsa-miR-6514-5p	HITS-CLIP	27418678
MIRT679392	hsa-miR-8055	HITS-CLIP	27418678
MIRT679398	hsa-miR-8082	HITS-CLIP	27418678
MIRT679405	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT620783	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT679404	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT679403	hsa-miR-4770	HITS-CLIP	23824327
MIRT679402	hsa-miR-6088	HITS-CLIP	23824327
MIRT679401	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT679400	hsa-miR-1273f	HITS-CLIP	23824327
MIRT679399	hsa-miR-4534	HITS-CLIP	23824327
MIRT679398	hsa-miR-8082	HITS-CLIP	23824327
MIRT679397	hsa-miR-1289	HITS-CLIP	23824327
MIRT679396	hsa-miR-4294	HITS-CLIP	23824327
MIRT679395	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT679394	hsa-miR-3198	HITS-CLIP	23824327
MIRT679393	hsa-miR-4309	HITS-CLIP	23824327
MIRT679392	hsa-miR-8055	HITS-CLIP	23824327
MIRT679391	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT620786	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT648717	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648716	hsa-miR-4532	HITS-CLIP	23824327
MIRT620785	hsa-miR-5193	HITS-CLIP	23824327
MIRT620784	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT648715	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT620783	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648714	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT648713	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT620782	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT648712	hsa-miR-4284	HITS-CLIP	23824327
MIRT620781	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT620786	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT620785	hsa-miR-5193	HITS-CLIP	23824327
MIRT620784	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT620783	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT620782	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT620781	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT1063505	hsa-miR-103a	CLIP-seq
MIRT1063506	hsa-miR-107	CLIP-seq
MIRT1063507	hsa-miR-1206	CLIP-seq
MIRT1063508	hsa-miR-122	CLIP-seq
MIRT1063509	hsa-miR-1226	CLIP-seq
MIRT1063510	hsa-miR-1279	CLIP-seq
MIRT1063511	hsa-miR-136	CLIP-seq
MIRT1063512	hsa-miR-15a	CLIP-seq
MIRT1063513	hsa-miR-15b	CLIP-seq
MIRT1063514	hsa-miR-16	CLIP-seq
MIRT1063515	hsa-miR-194	CLIP-seq
MIRT1063516	hsa-miR-195	CLIP-seq
MIRT1063517	hsa-miR-197	CLIP-seq
MIRT1063518	hsa-miR-29a	CLIP-seq
MIRT1063519	hsa-miR-29b	CLIP-seq
MIRT1063520	hsa-miR-29c	CLIP-seq
MIRT1063521	hsa-miR-3135b	CLIP-seq
MIRT1063522	hsa-miR-3149	CLIP-seq
MIRT1063523	hsa-miR-3187-3p	CLIP-seq
MIRT1063524	hsa-miR-3545-3p	CLIP-seq
MIRT1063525	hsa-miR-3652	CLIP-seq
MIRT1063526	hsa-miR-3663-3p	CLIP-seq
MIRT1063527	hsa-miR-3663-5p	CLIP-seq
MIRT1063528	hsa-miR-371-3p	CLIP-seq
MIRT1063529	hsa-miR-411	CLIP-seq
MIRT1063530	hsa-miR-424	CLIP-seq
MIRT1063531	hsa-miR-4430	CLIP-seq
MIRT1063532	hsa-miR-4435	CLIP-seq
MIRT1063533	hsa-miR-4463	CLIP-seq
MIRT1063534	hsa-miR-4530	CLIP-seq
MIRT1063535	hsa-miR-4635	CLIP-seq
MIRT1063536	hsa-miR-4680-5p	CLIP-seq
MIRT1063537	hsa-miR-4701-5p	CLIP-seq
MIRT1063538	hsa-miR-4755-3p	CLIP-seq
MIRT1063539	hsa-miR-497	CLIP-seq
MIRT1063540	hsa-miR-5096	CLIP-seq
MIRT1063541	hsa-miR-548s	CLIP-seq
MIRT1063542	hsa-miR-588	CLIP-seq
MIRT1063543	hsa-miR-629	CLIP-seq
MIRT1063544	hsa-miR-634	CLIP-seq
MIRT2014995	hsa-miR-1182	CLIP-seq
MIRT1063508	hsa-miR-122	CLIP-seq
MIRT2014996	hsa-miR-1245	CLIP-seq
MIRT1063510	hsa-miR-1279	CLIP-seq
MIRT1063517	hsa-miR-197	CLIP-seq
MIRT2014997	hsa-miR-1976	CLIP-seq
MIRT2014998	hsa-miR-299-3p	CLIP-seq
MIRT1063521	hsa-miR-3135b	CLIP-seq
MIRT2014999	hsa-miR-3168	CLIP-seq
MIRT2015000	hsa-miR-3192	CLIP-seq
MIRT1063524	hsa-miR-3545-3p	CLIP-seq
MIRT1063525	hsa-miR-3652	CLIP-seq
MIRT1063527	hsa-miR-3663-5p	CLIP-seq
MIRT1063528	hsa-miR-371-3p	CLIP-seq
MIRT2015001	hsa-miR-4269	CLIP-seq
MIRT2015002	hsa-miR-4279	CLIP-seq
MIRT2015003	hsa-miR-4314	CLIP-seq
MIRT1063531	hsa-miR-4430	CLIP-seq
MIRT1063532	hsa-miR-4435	CLIP-seq
MIRT2015004	hsa-miR-4454	CLIP-seq
MIRT2015005	hsa-miR-4514	CLIP-seq
MIRT1063535	hsa-miR-4635	CLIP-seq
MIRT2015006	hsa-miR-4646-5p	CLIP-seq
MIRT2015007	hsa-miR-4650-3p	CLIP-seq
MIRT1063536	hsa-miR-4680-5p	CLIP-seq
MIRT2015008	hsa-miR-4692	CLIP-seq
MIRT2015009	hsa-miR-4722-3p	CLIP-seq
MIRT2015010	hsa-miR-4742-5p	CLIP-seq
MIRT1063538	hsa-miR-4755-3p	CLIP-seq
MIRT2015011	hsa-miR-4763-5p	CLIP-seq
MIRT2015012	hsa-miR-4777-5p	CLIP-seq
MIRT1063540	hsa-miR-5096	CLIP-seq
MIRT2015013	hsa-miR-518d-5p	CLIP-seq
MIRT2015014	hsa-miR-519b-5p	CLIP-seq
MIRT2015015	hsa-miR-519c-5p	CLIP-seq
MIRT2015016	hsa-miR-520c-5p	CLIP-seq
MIRT2015017	hsa-miR-526a	CLIP-seq
MIRT2015018	hsa-miR-576-3p	CLIP-seq
MIRT1063543	hsa-miR-629	CLIP-seq
MIRT1063508	hsa-miR-122	CLIP-seq
MIRT2247344	hsa-miR-1291	CLIP-seq
MIRT2247345	hsa-miR-1307	CLIP-seq
MIRT1063521	hsa-miR-3135b	CLIP-seq
MIRT2247346	hsa-miR-328	CLIP-seq
MIRT1063525	hsa-miR-3652	CLIP-seq
MIRT1063528	hsa-miR-371-3p	CLIP-seq
MIRT1063531	hsa-miR-4430	CLIP-seq
MIRT2247344	hsa-miR-1291	CLIP-seq
MIRT2247345	hsa-miR-1307	CLIP-seq
MIRT2247346	hsa-miR-328	CLIP-seq
MIRT2451692	hsa-miR-3135	CLIP-seq
MIRT1063522	hsa-miR-3149	CLIP-seq
MIRT1063529	hsa-miR-411	CLIP-seq
MIRT1063533	hsa-miR-4463	CLIP-seq
MIRT2451693	hsa-miR-4735-5p	CLIP-seq
MIRT2451694	hsa-miR-4775	CLIP-seq
MIRT2451695	hsa-miR-590-3p	CLIP-seq
MIRT2451692	hsa-miR-3135	CLIP-seq
MIRT1063522	hsa-miR-3149	CLIP-seq
MIRT1063529	hsa-miR-411	CLIP-seq
MIRT2451693	hsa-miR-4735-5p	CLIP-seq
MIRT2451694	hsa-miR-4775	CLIP-seq
MIRT2451695	hsa-miR-590-3p	CLIP-seq
MIRT1063507	hsa-miR-1206	CLIP-seq
MIRT2014997	hsa-miR-1976	CLIP-seq
MIRT2451692	hsa-miR-3135	CLIP-seq
MIRT1063522	hsa-miR-3149	CLIP-seq
MIRT1063529	hsa-miR-411	CLIP-seq
MIRT2015001	hsa-miR-4269	CLIP-seq
MIRT2015002	hsa-miR-4279	CLIP-seq
MIRT1063533	hsa-miR-4463	CLIP-seq
MIRT2015005	hsa-miR-4514	CLIP-seq
MIRT2015008	hsa-miR-4692	CLIP-seq
MIRT2015009	hsa-miR-4722-3p	CLIP-seq
MIRT2451693	hsa-miR-4735-5p	CLIP-seq
MIRT2015010	hsa-miR-4742-5p	CLIP-seq
MIRT2451694	hsa-miR-4775	CLIP-seq
MIRT2550757	hsa-miR-4787-3p	CLIP-seq
MIRT2451695	hsa-miR-590-3p	CLIP-seq
MIRT1063507	hsa-miR-1206	CLIP-seq
MIRT2014997	hsa-miR-1976	CLIP-seq
MIRT2451692	hsa-miR-3135	CLIP-seq
MIRT1063522	hsa-miR-3149	CLIP-seq
MIRT1063529	hsa-miR-411	CLIP-seq
MIRT2015001	hsa-miR-4269	CLIP-seq
MIRT2015002	hsa-miR-4279	CLIP-seq
MIRT1063533	hsa-miR-4463	CLIP-seq
MIRT2015005	hsa-miR-4514	CLIP-seq
MIRT2015008	hsa-miR-4692	CLIP-seq
MIRT2015009	hsa-miR-4722-3p	CLIP-seq
MIRT2451693	hsa-miR-4735-5p	CLIP-seq
MIRT2015010	hsa-miR-4742-5p	CLIP-seq
MIRT2451694	hsa-miR-4775	CLIP-seq
MIRT2550757	hsa-miR-4787-3p	CLIP-seq
MIRT2451695	hsa-miR-590-3p	CLIP-seq
MIRT1063543	hsa-miR-629	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004920	Function	Interleukin-10 receptor activity	IBA
GO:0004920	Function	Interleukin-10 receptor activity	TAS	10954742
GO:0005515	Function	Protein binding	IPI	12483210, 12513909, 15120653, 16982608, 20462497
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	16982608
GO:0005886	Component	Plasma membrane	TAS	10954742
GO:0006954	Process	Inflammatory response	TAS	10954742
GO:0006955	Process	Immune response	TAS	9463407
GO:0007165	Process	Signal transduction	TAS	10954742
GO:0015026	Function	Coreceptor activity	IDA	16982608
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9312047
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0032002	Component	Interleukin-28 receptor complex	NAS	12483210
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	8314576
GO:0038196	Process	Type III interferon-mediated signaling pathway	NAS	30936491
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16982608
GO:0051607	Process	Defense response to virus	IEA
GO:0098586	Process	Cellular response to virus	NAS	30936491
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	16982608
GO:1901857	Process	Positive regulation of cellular respiration	IMP	25930096

MIM	HGNC	e!Ensembl
123889	5965	ENSG00000243646

Q08334

Protein name

Interleukin-10 receptor subunit beta (IL-10 receptor subunit beta) (IL-10R subunit beta) (IL-10RB) (Cytokine receptor class-II member 4) (Cytokine receptor family 2 member 4) (CRF2-4) (Interleukin-10 receptor subunit 2) (IL-10R subunit 2) (IL-10R2) (CD an

Protein function

Shared cell surface receptor required for the activation of five class 2 cytokines: IL10, IL22, IL26, IL28, and IFNL1. The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The liga

PDB

3LQM , 5T5W , 6X93 , 9BPU , 9BPV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01108	Tissue_fac	2 → 100	Tissue factor	Family
PF09294	Interfer-bind	111 → 213	Interferon-alpha/beta receptor, fibronectin type III	Domain

Sequence

MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYR
IFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV
EVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLG
CFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
DSESGKQNPGDSCSLGTPPGQGPQS

Sequence length

325

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor JAK-STAT signaling pathway Toxoplasmosis Tuberculosis Human cytomegalovirus infection		Other interleukin signaling Interleukin-10 signaling Interleukin-20 family signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Inflammatory bowel disease 25	Likely pathogenic; Pathogenic	rs1989179205, rs2123556583, rs2123561272, rs2516790668, rs2516776217, rs1989175848, rs121909601, rs387907326, rs1329427406, rs1373354533, rs1989014468, rs920292604	RCV001330007 RCV001377748 RCV001377497 RCV004565062 RCV004560170 View all (7 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B virus, susceptibility to	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL10RB-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION, INFLAMMATORY BOWEL DISEASE, ARTHRITIS, RECURRENT INFECTION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION-INFLAMMATORY BOWEL DISEASE-ARTHRITIS-RECURRENT INFECTIONS SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory bowel disease	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE 25, AUTOSOMAL RECESSIVE	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (73)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	Pubtator	22550014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24286242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24023707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24089328, 30212871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	35455984	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21532858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	36475797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	29549834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	40404687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	39366640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	19890111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24792912, 29788382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24379584, 27350736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	18254984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22550014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22550014, 33595362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	23852407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	19577285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39202464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25733167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	35255492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22050548, 2529205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	33260695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19577285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	35455984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24133578	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	19890111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	24507158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Folliculitis	Folliculitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28864178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	16109775	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19409109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	16109775, 19295315		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Defects Congenital	Congenital heart defect	Pubtator	33260695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	33260695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	16757563	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	23096091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 25 Autosomal Recessive	Inflammatory bowel disease	Pubtator	27350736, 36308662, 37503744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
INFLAMMATORY BOWEL DISEASE 25, AUTOSOMAL RECESSIVE	Inflammatory Bowel Disease	GENOMICS_ENGLAND_DG	19890111, 21519361, 27302973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE 25, AUTOSOMAL RECESSIVE	Inflammatory Bowel Disease	CLINVAR_DG	22549091, 27336593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE 25, AUTOSOMAL RECESSIVE	Inflammatory Bowel Disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19890111, 27350736, 28785144, 31819956, 32925557, 36002022	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GENOMICS_ENGLAND_DG	21519361		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22549091, 22550014, 29248579, 29788382, 31096038, 31819956		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	23096091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	21917900, 24578538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	24578538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25032264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36308662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	36308662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33246355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37511050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17988330, 23749100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20103601, 36475797	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19626699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27405747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28225209		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	40429759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	24204295, 32669953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18509351, 27058892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35205336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39972314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24419231, 38538250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33062039	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Perianal abscess	Perianal abscess	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	21532858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16859503, 24286242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30630651	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18588853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GENOMICS_ENGLAND_DG	21519361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22550014		★★★★★ ★☆☆☆☆ Found in Text Mining only

IL10RB (interleukin 10 receptor subunit beta)