IL10RA (interleukin 10 receptor subunit alpha)

Gene

• Entrez ID: 3587
• Gene name: Interleukin 10 receptor subunit alpha
• Gene symbol: IL10RA
• Synonyms (NCBI Gene): CD210, CD210a, CDW210A, HIL-10R, IL-10R1, IL10R
• Chromosome: 11
• Chromosome location: 11q23.3
• Summary: The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammator

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853579	G>A,C	Pathogenic	Coding sequence variant, non coding transcript variant, 5 prime UTR variant, missense variant
rs137853580	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs138929400	T>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, missense variant
rs148808529	T>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, synonymous variant, coding sequence variant
rs149491038	C>T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs199604463	G>A	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, synonymous variant
rs201396764	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, missense variant
rs201643277	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, 5 prime UTR variant, missense variant
rs368287711	C>A,T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant, synonymous variant, intron variant
rs377525753	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, synonymous variant, coding sequence variant, non coding transcript variant
rs560128585	A>C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	5 prime UTR variant, synonymous variant, coding sequence variant, non coding transcript variant
rs1192830343	C>T	Likely-pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs1419560997	G>A	Pathogenic	Synonymous variant, coding sequence variant, non coding transcript variant
rs1591263883	C>T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT491524	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT491523	hsa-miR-548q	PAR-CLIP	23592263
MIRT491522	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT491521	hsa-miR-558	PAR-CLIP	23592263
MIRT491520	hsa-miR-4487	PAR-CLIP	23592263
MIRT491519	hsa-miR-6089	PAR-CLIP	23592263
MIRT491518	hsa-miR-138-5p	PAR-CLIP	23592263
MIRT491517	hsa-miR-483-3p	PAR-CLIP	23592263
MIRT491516	hsa-miR-8064	PAR-CLIP	23592263
MIRT491524	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT491523	hsa-miR-548q	PAR-CLIP	23592263
MIRT491522	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT491521	hsa-miR-558	PAR-CLIP	23592263
MIRT491520	hsa-miR-4487	PAR-CLIP	23592263
MIRT491519	hsa-miR-6089	PAR-CLIP	23592263
MIRT491518	hsa-miR-138-5p	PAR-CLIP	23592263
MIRT491517	hsa-miR-483-3p	PAR-CLIP	23592263
MIRT491516	hsa-miR-8064	PAR-CLIP	23592263
MIRT1063473	hsa-miR-1184	CLIP-seq
MIRT1063474	hsa-miR-1205	CLIP-seq
MIRT1063475	hsa-miR-1208	CLIP-seq
MIRT1063476	hsa-miR-1237	CLIP-seq
MIRT1063477	hsa-miR-1238	CLIP-seq
MIRT1063478	hsa-miR-1913	CLIP-seq
MIRT1063479	hsa-miR-1915	CLIP-seq
MIRT1063480	hsa-miR-19a	CLIP-seq
MIRT1063481	hsa-miR-19b	CLIP-seq
MIRT1063482	hsa-miR-214	CLIP-seq
MIRT1063483	hsa-miR-3158-5p	CLIP-seq
MIRT1063484	hsa-miR-3189-5p	CLIP-seq
MIRT1063485	hsa-miR-3194-3p	CLIP-seq
MIRT1063486	hsa-miR-324-3p	CLIP-seq
MIRT1063487	hsa-miR-3619-5p	CLIP-seq
MIRT1063488	hsa-miR-4283	CLIP-seq
MIRT1063489	hsa-miR-4291	CLIP-seq
MIRT1063490	hsa-miR-4314	CLIP-seq
MIRT1063491	hsa-miR-4420	CLIP-seq
MIRT1063492	hsa-miR-4489	CLIP-seq
MIRT1063493	hsa-miR-4667-5p	CLIP-seq
MIRT1063494	hsa-miR-4675	CLIP-seq
MIRT1063495	hsa-miR-4700-5p	CLIP-seq
MIRT1063496	hsa-miR-4711-3p	CLIP-seq
MIRT1063497	hsa-miR-4727-5p	CLIP-seq
MIRT1063498	hsa-miR-4741	CLIP-seq
MIRT1063499	hsa-miR-4758-3p	CLIP-seq
MIRT1063500	hsa-miR-4769-3p	CLIP-seq
MIRT1063501	hsa-miR-637	CLIP-seq
MIRT1063502	hsa-miR-660	CLIP-seq
MIRT1063503	hsa-miR-761	CLIP-seq
MIRT1063504	hsa-miR-922	CLIP-seq
MIRT1063475	hsa-miR-1208	CLIP-seq
MIRT1063480	hsa-miR-19a	CLIP-seq
MIRT1063481	hsa-miR-19b	CLIP-seq
MIRT1063491	hsa-miR-4420	CLIP-seq
MIRT2247343	hsa-miR-493	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004920	Function	Interleukin-10 receptor activity	IBA
GO:0004920	Function	Interleukin-10 receptor activity	IDA	16982608, 24367025
GO:0004920	Function	Interleukin-10 receptor activity	IEA
GO:0004920	Function	Interleukin-10 receptor activity	TAS	8120391
GO:0005515	Function	Protein binding	IPI	11485736, 12093920, 12513909, 15837194, 16982608, 18395809, 20462497, 22087322, 24008843, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	16982608
GO:0005886	Component	Plasma membrane	IDA	22087322
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8407942
GO:0005929	Component	Cilium	IDA
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	22087322
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019969	Function	Interleukin-10 binding	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0038023	Function	Signaling receptor activity	TAS	8407942
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16982608
GO:0050728	Process	Negative regulation of inflammatory response	IDA	24367025
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	IDA	29454749
GO:0070086	Process	Ubiquitin-dependent endocytosis	IDA	22087322
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512, 16982608
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	16982608

Other IDs

• MIM: 146933
• HGNC: 5964
• e!Ensembl: ENSG00000110324

Protein

• UniProt ID: Q13651
• Protein name: Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
• Protein function: Cell surface receptor for the cytokine IL10 that participates in IL10-mediated anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Upon binding to IL10, induces a conformational change in IL10RB, allowing IL
• PDB: 1J7V, 1LQS, 1Y6K, 1Y6M, 1Y6N, 5IXI, 6X93
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01108	Tissue_fac	4 → 111	Tissue factor	Family

• Tissue specificity: TISSUE SPECIFICITY: Primarily expressed in hematopoetic cells including B-cells, T-cells, NK cells, monocytes and macrophages. Not expressed in non-hematopoetic cells such as fibroblasts or endothelial cells.
• Sequence:

  MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
  LLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSV
  DEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
  THKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFF
  AFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
  FLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSC
  SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
  ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRC
  LVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWS
  FAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE

• Sequence length: 578

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway
Toxoplasmosis
Tuberculosis
Human cytomegalovirus infection

Reactome:

Interleukin-10 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
IL10RA-related disorder	Likely pathogenic; Pathogenic	rs368287711	RCV003398584	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Inflammatory bowel disease 28	Pathogenic; Likely pathogenic	rs2134991615, rs1187971271, rs1214626558, rs1414190221, rs1027503096, rs1415553044, rs2496780587, rs2058036751, rs759537444, rs137853579, rs137853580, rs149491038, rs368287711, rs1192830343, rs1419560997, rs1591263883, rs369219156	RCV001387734 RCV001972249 RCV001974279 RCV001966719 RCV003037432 RCV002775181 RCV002852849 RCV003527027 RCV003527589 RCV000015937 RCV000015938 RCV000032625 RCV000032627 RCV000988744 RCV001030031 RCV001030032 RCV001214188	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION, INFLAMMATORY BOWEL DISEASE, ARTHRITIS, RECURRENT INFECTION SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION-INFLAMMATORY BOWEL DISEASE-ARTHRITIS-RECURRENT INFECTIONS SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory bowel disease	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE 28, AUTOSOMAL RECESSIVE	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27268052		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16971956		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	12595905		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22550014		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22550014	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16859503	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36614150	Inhibit	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22649007, 24089328, 30212871		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21532858		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24593764		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28982901		★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	28982901		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24593764		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30485902	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18344594	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36703911	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	17115186		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	37861500	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	32303241	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17331973		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17331973		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	30922293	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	19890111, 33405352	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21519361, 24367025, 24785691, 27693323, 28098246, 28678006		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22550014, 24379584, 33405352	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29730384		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	18254984	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36077487	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12759436, 22476154, 22550014, 28082818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	31889944, 32587451, 35311452	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	18026571	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	20232770	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10563471		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35909518	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	33849446	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25733167, 27268052		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	32587451	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	19890111, 22890722, 23158016, 23839161		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	19890111	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	16049284	Associate	★☆☆☆☆ Found in Text Mining only
Folliculitis	Folliculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28864178		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	17961716		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	37511050	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	26822028	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24081683	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16971956		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	36077487	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23096091		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15809201	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37325673	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	26822028		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29788474		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 25 Autosomal Recessive	Inflammatory bowel disease	Pubtator	26193622, 27350736, 33849446, 34730757, 34908808, 37986047	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 28 Autosomal Recessive	Inflammatory bowel disease	Pubtator	31648101	Associate	★☆☆☆☆ Found in Text Mining only
INFLAMMATORY BOWEL DISEASE 28, AUTOSOMAL RECESSIVE	Inflammatory Bowel Disease	UNIPROT_DG	19890111, 23839161, 24785691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE 28, AUTOSOMAL RECESSIVE	Inflammatory Bowel Disease	GENOMICS_ENGLAND_DG	27302973, 29059189		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE 28, AUTOSOMAL RECESSIVE	Inflammatory Bowel Disease	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19890111, 22550014, 24001973, 24089328, 26822028, 27350736, 27903283, 28082818, 30365510, 31648101, 32117262, 32351297, 32587451, 32925557, 33505153, 33849446, 34530396, 34730757, 34908808, 36370291, 37986047	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22549091, 22550014, 22890722, 23839161, 24519095, 24785691, 24813381, 26822028, 27177777, 27693323, 28678006, 29023267, 29140941, 29399122, 29755507, 29788474, 30199474, 30462267, 31096038, 31648101		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GENOMICS_ENGLAND_DG	27302973		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31417161	Inhibit	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23096091		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	26822028		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	38174742	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	21917900		★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	26822028	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15729365		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	20531015	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	36308662	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12591723		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21635228, 37511050	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10556270, 21635228, 22652629		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17988330		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	21635228		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	21635228	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16971956		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	22649007		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	22649007		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28903065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24593764		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14726694, 23921087, 25720800, 26631117	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27397081		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	27091721	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	16049284	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	36077487	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11122145	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27405747		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12101075, 28225209		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18200504	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	24741599, 36466903	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28982901, 29730384, 30404730		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	21635228, 29866800		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28903065		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	28903065	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20430716, 37800814	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33845841	Associate	★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	23455702		★☆☆☆☆ Found in Text Mining only
Perianal abscess	Perianal abscess	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	22155628		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28903065		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	21532858	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28903065	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	15729365		★☆☆☆☆ Found in Text Mining only
Pyoderma	Pyoderma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18344594		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10553089, 16859503, 21553228, 27796662		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17066477, 26481614, 27397081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17066477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17066477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30630651	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	27177777		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	32034084	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	12595905		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34091115	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18800073, 22550014		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18800073		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GENOMICS_ENGLAND_DG	27302973		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23280621	Associate	★☆☆☆☆ Found in Text Mining only