CXCR2 (C-X-C motif chemokine receptor 2)

Gene

• Entrez ID: 3579
• Gene name: C-X-C motif chemokine receptor 2
• Gene symbol: CXCR2
• Synonyms (NCBI Gene): CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB, WHIMS2
• Chromosome: 2
• Chromosome location: 2q35
• Summary: The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system.

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1574542732	A>T	Likely-pathogenic	Coding sequence variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017358	hsa-miR-335-5p	Microarray	18185580
MIRT647735	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT647734	hsa-miR-4293	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647733	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT647732	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT647731	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT647730	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT647729	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT647728	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647726	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT647725	hsa-miR-548s	HITS-CLIP	23824327
MIRT647724	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT647723	hsa-miR-588	HITS-CLIP	23824327
MIRT647722	hsa-miR-4435	HITS-CLIP	23824327
MIRT647721	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT647720	hsa-miR-5096	HITS-CLIP	23824327
MIRT732336	hsa-miR-22-3p	Flow, Gluc reporter assay, GUS reporter assay, HITS-CLIP, Immunoblot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunoprecipitaion	26364720
MIRT732336	hsa-miR-22-3p	Flow, Gluc reporter assay, GUS reporter assay, HITS-CLIP, Immunoblot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunoprecipitaion	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot, RNA immunoprecipitation assay (RIP)	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot, RNA immunoprecipitation assay (RIP)	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot, RNA immunoprecipitation assay (RIP)	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot	26364720
MIRT647735	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT647734	hsa-miR-4293	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647733	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT647732	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT647731	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT647730	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT647729	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT647728	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647726	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT647725	hsa-miR-548s	HITS-CLIP	23824327
MIRT647724	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT647723	hsa-miR-588	HITS-CLIP	23824327
MIRT647722	hsa-miR-4435	HITS-CLIP	23824327
MIRT647721	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT647720	hsa-miR-5096	HITS-CLIP	23824327
MIRT918176	hsa-miR-129-5p	CLIP-seq
MIRT918177	hsa-miR-1297	CLIP-seq
MIRT918178	hsa-miR-1307	CLIP-seq
MIRT918179	hsa-miR-142-5p	CLIP-seq
MIRT918180	hsa-miR-145	CLIP-seq
MIRT918181	hsa-miR-149	CLIP-seq
MIRT918182	hsa-miR-26a	CLIP-seq
MIRT918183	hsa-miR-26b	CLIP-seq
MIRT918184	hsa-miR-3064-5p	CLIP-seq
MIRT918185	hsa-miR-3149	CLIP-seq
MIRT918186	hsa-miR-411	CLIP-seq
MIRT918187	hsa-miR-4279	CLIP-seq
MIRT918188	hsa-miR-4284	CLIP-seq
MIRT918189	hsa-miR-4465	CLIP-seq
MIRT918190	hsa-miR-4532	CLIP-seq
MIRT918191	hsa-miR-4638-5p	CLIP-seq
MIRT918192	hsa-miR-4772-3p	CLIP-seq
MIRT918193	hsa-miR-4794	CLIP-seq
MIRT918194	hsa-miR-561	CLIP-seq
MIRT918195	hsa-miR-1298	CLIP-seq
MIRT918179	hsa-miR-142-5p	CLIP-seq
MIRT918196	hsa-miR-3160-5p	CLIP-seq
MIRT918197	hsa-miR-337-3p	CLIP-seq
MIRT918198	hsa-miR-4263	CLIP-seq
MIRT918199	hsa-miR-4265	CLIP-seq
MIRT918200	hsa-miR-4296	CLIP-seq
MIRT918201	hsa-miR-4322	CLIP-seq
MIRT918202	hsa-miR-4708-3p	CLIP-seq
MIRT918203	hsa-miR-4799-5p	CLIP-seq
MIRT918194	hsa-miR-561	CLIP-seq
MIRT918204	hsa-miR-576-5p	CLIP-seq
MIRT918205	hsa-miR-664	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq
MIRT2207967	hsa-miR-122	CLIP-seq
MIRT2207968	hsa-miR-1224-5p	CLIP-seq
MIRT918195	hsa-miR-1298	CLIP-seq
MIRT2207969	hsa-miR-1304	CLIP-seq
MIRT918179	hsa-miR-142-5p	CLIP-seq
MIRT2207970	hsa-miR-150	CLIP-seq
MIRT2207971	hsa-miR-1909	CLIP-seq
MIRT2207972	hsa-miR-197	CLIP-seq
MIRT2207973	hsa-miR-2052	CLIP-seq
MIRT2207974	hsa-miR-22	CLIP-seq
MIRT2207975	hsa-miR-3135b	CLIP-seq
MIRT2207976	hsa-miR-3155	CLIP-seq
MIRT2207977	hsa-miR-3155b	CLIP-seq
MIRT2207978	hsa-miR-320a	CLIP-seq
MIRT2207979	hsa-miR-320b	CLIP-seq
MIRT2207980	hsa-miR-320c	CLIP-seq
MIRT2207981	hsa-miR-320d	CLIP-seq
MIRT2207982	hsa-miR-3652	CLIP-seq
MIRT2207983	hsa-miR-3915	CLIP-seq
MIRT2207984	hsa-miR-3928	CLIP-seq
MIRT2207985	hsa-miR-4429	CLIP-seq
MIRT2207986	hsa-miR-4430	CLIP-seq
MIRT2207987	hsa-miR-4688	CLIP-seq
MIRT2207988	hsa-miR-4689	CLIP-seq
MIRT2207989	hsa-miR-4713-5p	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT2207990	hsa-miR-4769-3p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT2207991	hsa-miR-484	CLIP-seq
MIRT2207992	hsa-miR-532-3p	CLIP-seq
MIRT918194	hsa-miR-561	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq
MIRT918205	hsa-miR-664	CLIP-seq
MIRT918180	hsa-miR-145	CLIP-seq
MIRT918187	hsa-miR-4279	CLIP-seq
MIRT2465159	hsa-miR-3138	CLIP-seq
MIRT2465160	hsa-miR-4329	CLIP-seq
MIRT2465161	hsa-miR-4786-5p	CLIP-seq
MIRT2465162	hsa-miR-548b-3p	CLIP-seq
MIRT2465163	hsa-miR-769-5p	CLIP-seq
MIRT918176	hsa-miR-129-5p	CLIP-seq
MIRT918185	hsa-miR-3149	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq
MIRT918176	hsa-miR-129-5p	CLIP-seq
MIRT918185	hsa-miR-3149	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	18555777
NFKB1	Activation	19156404
NFKB1	Unknown	18555777
RELA	Activation	19156404
RELA	Unknown	18555777
USF2	Activation	10229837

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	IEA
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0004918	Function	Interleukin-8 receptor activity	IDA	10820279
GO:0004918	Function	Interleukin-8 receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	10438939
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17435771, 21876773, 22904195, 23597562, 32296183, 36613703
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8194768, 10438939
GO:0006935	Process	Chemotaxis	IDA	10725748
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	TAS	9725262
GO:0006955	Process	Immune response	IBA
GO:0006968	Process	Cellular defense response	IDA	10725748
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9079638
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10734056, 10878382
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	10438939
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10438939
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	10878382
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IDA	10725748
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016494	Function	C-X-C chemokine receptor activity	IDA	10878382
GO:0016494	Function	C-X-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019959	Function	Interleukin-8 binding	IEA
GO:0019959	Function	Interleukin-8 binding	IPI	1840701
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IDA	10820279
GO:0030667	Component	Secretory granule membrane	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031623	Process	Receptor internalization	IDA	10734056
GO:0031623	Process	Receptor internalization	IEA
GO:0038112	Process	Interleukin-8-mediated signaling pathway	IDA	10820279
GO:0042119	Process	Neutrophil activation	IDA	10878382
GO:0042629	Component	Mast cell granule	IDA	9725262
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0072686	Component	Mitotic spindle	IDA

Other IDs

• MIM: 146928
• HGNC: 6027
• e!Ensembl: ENSG00000180871

Protein

• UniProt ID: P25025
• Protein name: C-X-C chemokine receptor type 2 (CXC-R2) (CXCR-2) (CDw128b) (GRO/MGSA receptor) (High affinity interleukin-8 receptor B) (IL-8R B) (IL-8 receptor type 2) (CD antigen CD182)
• Protein function: Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor (PubMed:1891716). Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calc
• PDB: 4Q3H, 5TYT, 6KVA, 6KVF, 6LFM, 6LFO, 8XVU, 8XWA, 8XWF, 8XWM, 8XWN, 8XWS, 8XWV, 8XX3, 8XX6, 8XX7, 8XXH, 8XXR, 8XXX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	65 → 314	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
  LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
  VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
  LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
  AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
  ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
  

• Sequence length: 360

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Phospholipase D signaling pathway
Endocytosis
Epithelial cell signaling in Helicobacter pylori infection
Human cytomegalovirus infection

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
WHIM syndrome 2	Pathogenic; Likely pathogenic	rs2106109435, rs1273183086	RCV001532874 RCV001824265	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE SEVERE CONGENITAL NEUTROPENIA DUE TO C-X-C MOTIF CHEMOKINE RECEPTOR 2 DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE SEVERE CONGENITAL NEUTROPENIA DUE TO CXCR2 DEFICIENCY	—	GenCC, Orphanet GenCC, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CXCR2-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25810490		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22389383		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21328342, 23204236		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31801883		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	12532104		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	26086549		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	BEFREE	10902769		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33804025	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21084199		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21383500		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21926469, 28214673, 29196437, 30659170, 31024520		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	16308497	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	16308497, 30535755		★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	BEFREE	25563839		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	27417541	Stimulate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	16308497		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	16308497	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18276907, 21441140		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12444152, 31076525		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	16987681		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	15482477	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	9424095	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12932287, 33087182, 8863160	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12626595, 16897191, 24582314, 30682452, 30804927		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17234659, 31903716, 33602227	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24641287	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22231733, 9334359	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	9334359		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18276907, 21441140		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36094626	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30760287		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	30760287, 32383373, 33755965, 35305619, 35790963, 36042613	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal recessive severe congenital neutropenia due to CXCR2 deficiency	Congenital Neutropenia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28416308		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	15630732, 17257314, 17265155		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	31884679	Inhibit	★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	18676870		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	18676870	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	24493287		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	18676870	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26058729, 27721403, 28423359		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	31562303		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	12244149	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Traumatic	Brain injuries	Pubtator	35768823	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33807899	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17949231, 20540789, 22789011, 24388382, 24403602, 28964785, 30094610, 30233217, 30788286, 31562303, 31654638		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20540789, 22789011, 23149820, 32702599, 35280694	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	12626595		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	24970800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	10747307	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10914718, 21328342, 30944253		★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	36140779	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26503598, 27807540, 31684995, 35038357, 36411463, 37403022	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26058729, 27721403, 28423359		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17361014, 23204236, 25480945		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	40269781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24593195, 27273823, 27297979, 28923105	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	22389383, 25512615	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20505188, 24376747, 27723802, 29515768, 29632724, 29703902, 30181917		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36936778	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	22789011		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	16308497	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26648969, 31883451	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	31883451	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28865993, 30760287		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30257367		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30257367		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	29160519	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18676870, 27959418		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35377900	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	24493287, 28763485		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	28970523		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23615182, 26790439		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29146966		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12857718, 16429233, 19026683, 26747783, 30804927, 30958968		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22051099, 30863202	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25710489		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32190668, 36860851, 39328405	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15787094, 21042742, 22274915, 22617157, 22674296, 24338666, 25580640		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	35879507	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12496258	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22391039, 22617157, 25580640, 26071399, 28415702, 30705034, 30905761		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16098254		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18959627, 21285972, 21791631, 22674296, 25541970, 25580640, 28415702, 30820706, 34083590, 35212311, 35687912	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	24493287		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	24777453		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29514257, 31494226		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16210641, 24593195, 27273823, 28923105, 30246456		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21915051		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21915051, 26287498		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21915051		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26071399		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	35795659	Associate	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	22152684	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	LHGDN	18199703		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	22088968	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	19026683, 22088968, 30540818		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19046427, 22088968	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	15105284, 30068506		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12932287, 17265155		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	31243125		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	23470693	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31034777		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	31431611	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	25172501, 29167025		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	14657882		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30718298		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31010531	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36329882, 36919187	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28387853		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	25222246	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	14657882		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	12244149		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	19549892		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22626766		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15618253		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30015967		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30015967	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	28736230	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28705496		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28705496		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16540656, 19435811		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16540656, 19435811		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19435811, 26231560	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31485619	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	38401086	Inhibit	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	26648969	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	33478117	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23661906		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	23661906	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23661906		★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	18676870	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	15793866	Inhibit	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	30718298		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23029099, 30086759, 33807899, 35856448, 37686093	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30236892, 9334359		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30127875, 30236892, 9334359		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30236892		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33089764	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	24023680	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	37730733	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	10196223, 11076803, 9079638	Associate	★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	10902769		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	37730733	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	25222246	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29514257		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29514257, 31494226		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28151558	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	29344240		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	26608915		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21900197, 29514257, 31364370, 31494226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	27678262		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10902769, 28862882		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	39991151	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	21214373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10786999		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22419656, 24487271, 9414973		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35022690	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	25172501, 29167025		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	24338666		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	BEFREE	24338666		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	17949231, 22789011		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10438939, 15110993, 19446723		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	19642907		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21214373		★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	26790439	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	26790439	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31812015		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23615182, 26790439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	27273823	Stimulate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	22274915		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	14632750		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18842429, 29146966, 36129940	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26462087	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25810490, 30592634		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26462152		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20018298, 24332572, 25462858, 26503598, 27807540, 31021443		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	23661906	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24736615	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver cyst	Liver Cyst	BEFREE	18199703		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21731723	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	Pubtator	24736615	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	19026683, 22088968, 31080358		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33246355	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19309748, 25480945	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21328342		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38158808	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18208820, 27768123		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	22274915, 31390756		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26497045, 31731888	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28575019, 31793192	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18842429	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35887224	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	18842429	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31431611		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17949231, 20540789, 22789011, 22893608, 24388382, 24403602, 28964785, 30233217, 30788286, 31562303, 31654638		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16540656, 19435811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31173199, 31516616		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17361014, 23204236, 25480945, 26462152		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26462152		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20505188, 24376747, 27723802, 29515768, 29632724, 29703902, 30181917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19057948, 19431209, 21356384, 22815748, 31002348, 31488817		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16679868, 26837773, 28668699, 29917166, 31433989, 31801883		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21343381, 25022956, 28481874, 30796034, 31810929		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28415590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26058729, 27721403, 28423359		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19047154, 20018298, 20505188, 22626766, 24953191, 25462858, 25810490, 26837773, 27028996, 27324095, 27737879, 28205614, 28455419, 28575019, 28874093, 30233217, 30257327, 30552676, 30703432, 30820706, 31043491, 31091832, 31390756, 31442409, 31654638		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15787094, 21042742, 22274915, 22617157, 22674296, 24338666, 25580640		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22770218, 22789011, 30871004		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14713106, 19147552		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19147552, 19401689, 19585580, 30221044		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19401689, 37686093, 8363581	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31034777		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31573846		★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	25810490		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26462152	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	18561120		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16793206, 17960472, 23876169, 25697397, 27820602, 30704100, 31243125		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30704100	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	28736230	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25810490		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	15454487		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25349304		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	30659170		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24462138		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23403077, 29665837		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22231733	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30314693		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12077278, 16210641, 16618733, 19431209, 20018298, 20505188, 20540789, 21328342, 22391039, 22617157, 22626766, 22789011, 23204236, 23548249, 24845798, 24848257, 24885595, 25022956, 25200966, 25462858, 25512615, 26071399, 26402907, 26503598, 26829987, 27236805, 27375023, 27556695, 27737879, 27799249, 28446981, 28450382, 28481874, 28575019, 29136508, 29507619, 29632724, 29703902, 30221044, 30233217, 30236892, 30404567, 30479461, 30546960, 30703432, 30705034, 30796034, 30871004, 30873585, 30905761, 30944253, 31091832, 31125710, 31395859, 31433989, 31571912, 31654638, 31801883		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	11313419, 30257327		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	30648122		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31616413		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	12857718, 19864593, 28277406, 29117499		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26608915		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15545974, 23204236, 23548249		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	23661906		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	29445104		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33087182	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30984000, 31696204		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35920183	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20505188, 24376747, 27723802, 29515768, 29632724, 29703902, 30181917		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19010874, 24376747, 26462152, 27028996, 31793192, 33829065, 34840630	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19057948, 19431209, 21356384, 22815748, 31002348, 31488817		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21926469, 27265504, 27737879, 30659170		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	27737879		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23293110, 31731578, 31999765, 32051287, 36012531, 36585453	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32867211	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	37686093	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29471001, 30404567		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	28151558		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27737879		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	LHGDN	15793866		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	20070156		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	35795659	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30991054		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30991054		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	28575019	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	10747307	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31652327		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	10747307	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	18199703		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	18199703		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	29018439		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	15454487		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	15454487		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	18552386		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10477904, 16679868, 26837773, 28668699, 29917166, 31433989, 31801883		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	32542667	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	29948377		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11180010, 15482477, 9424095		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	15482477	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	9424095	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	22088968		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35018096	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	24582314		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	24487271		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22674296, 25541970		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16210641, 24593195, 27273823, 28923105, 30246456		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24848257		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12932287, 17265155, 26111149, 9002042		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24848257		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	15110993	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	10902769	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25580640		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	17138957		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28878779, 30829852		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	22789011		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15545974		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15545974, 16721367	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24953191		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15598788, 25358439		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27557518, 34911941	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23661906		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21343381, 25022956, 27556695, 28481874, 30796034, 31810929		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	36614059	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14632759, 18025257, 21343381, 26497045, 28575019, 35377900, 38319150	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	29445104		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	26648969, 30760287, 31883451	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10902769, 19057948, 22763041		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19006565		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	10747307	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28415590		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28415590		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30089134	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30233217		★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	30659170		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	21297633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	9414973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19252927	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30816487	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24551277, 35264061	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37653753	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	22152684	Inhibit	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	23359652	Associate	★☆☆☆☆ Found in Text Mining only