IL6R (interleukin 6 receptor)

Gene

• Entrez ID: 3570
• Gene name: Interleukin 6 receptor
• Gene symbol: IL6R
• Synonyms (NCBI Gene): CD126, HIES5, IL-1Ra, IL-6R, IL-6R-1, IL-6RA, IL6Q, IL6QTL, IL6RA, IL6RQ, gp80
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein comple

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005528	hsa-miR-23a-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	20698883
MIRT006541	hsa-miR-124-3p	ELISA, Flow, Immunohistochemistry, Immunoprecipitaion, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22153071
MIRT006541	hsa-miR-124-3p	ELISA, Flow, Immunohistochemistry, Immunoprecipitaion, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22153071
MIRT006844	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22942733
MIRT006844	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22942733
MIRT027423	hsa-miR-98-5p	Microarray	19088304
MIRT006844	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22824797
MIRT054843	hsa-miR-451a	qRT-PCR, Western blot	24445140
MIRT438704	hsa-miR-34a-5p	ChIP-seq, Immunofluorescence, qRT-PCR, Western blot	24642471
MIRT438703	hsa-miR-34b-3p	ChIP-seq, Immunofluorescence, qRT-PCR, Western blot	24642471
MIRT438702	hsa-miR-34c-5p	ChIP-seq, Immunofluorescence, qRT-PCR, Western blot	24642471
MIRT438704	hsa-miR-34a-5p	ChIP-seq, Immunofluorescence, qRT-PCR, Western blot	24642471
MIRT438703	hsa-miR-34b-3p	ChIP-seq, Immunofluorescence, qRT-PCR, Western blot	24642471
MIRT438702	hsa-miR-34c-5p	ChIP-seq, Immunofluorescence, qRT-PCR, Western blot	24642471
MIRT714013	hsa-miR-548at-3p	HITS-CLIP	19536157
MIRT714012	hsa-miR-548ay-3p	HITS-CLIP	19536157
MIRT714011	hsa-miR-1537-3p	HITS-CLIP	19536157
MIRT054843	hsa-miR-451a	HITS-CLIP	19536157
MIRT714010	hsa-miR-5197-5p	HITS-CLIP	19536157
MIRT714009	hsa-miR-5680	HITS-CLIP	19536157
MIRT714008	hsa-miR-4330	HITS-CLIP	19536157
MIRT714007	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT714006	hsa-miR-2052	HITS-CLIP	19536157
MIRT714005	hsa-miR-7641	HITS-CLIP	19536157
MIRT687901	hsa-miR-4418	HITS-CLIP	23313552
MIRT687900	hsa-miR-509-3-5p	HITS-CLIP	23313552
MIRT687899	hsa-miR-509-5p	HITS-CLIP	23313552
MIRT687898	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT687897	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT687896	hsa-miR-1915-3p	HITS-CLIP	23313552
MIRT687895	hsa-miR-6764-5p	HITS-CLIP	23313552
MIRT687894	hsa-miR-4726-3p	HITS-CLIP	23313552
MIRT687893	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT687892	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT687891	hsa-miR-1307-3p	HITS-CLIP	23313552
MIRT687890	hsa-miR-4638-5p	HITS-CLIP	23313552
MIRT687889	hsa-miR-1184	HITS-CLIP	23313552
MIRT687888	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687887	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687886	hsa-miR-4284	HITS-CLIP	23313552
MIRT687885	hsa-miR-192-5p	HITS-CLIP	23313552
MIRT687884	hsa-miR-215-5p	HITS-CLIP	23313552
MIRT687883	hsa-miR-7156-3p	HITS-CLIP	23313552
MIRT646824	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT646823	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT646822	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT646821	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT646820	hsa-miR-5096	HITS-CLIP	23824327
MIRT646819	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT523017	hsa-miR-4438	PAR-CLIP	23446348
MIRT523016	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT523015	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT523014	hsa-miR-4722-3p	PAR-CLIP	23446348
MIRT523013	hsa-miR-6727-3p	PAR-CLIP	23446348
MIRT523012	hsa-miR-6747-3p	PAR-CLIP	23446348
MIRT523011	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT523010	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT523008	hsa-miR-5095	PAR-CLIP	23446348
MIRT523009	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT523007	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT523006	hsa-miR-3619-3p	PAR-CLIP	23446348
MIRT523005	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT054843	hsa-miR-451a	Luciferase reporter assay	25623956
MIRT732213	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR, Western blot	26645045
MIRT732213	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR, Western blot	26645045
MIRT732213	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR, Western blot	26645045
MIRT732213	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR, Western blot	26645045
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25973020
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assay	26091352
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assay	26091352
MIRT006541	hsa-miR-124-3p	ELISA, Flow, qRT-PCR, Western blot	27824145
MIRT027423	hsa-miR-98-5p	PAR-CLIP	27292025
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assay	32391256
MIRT054843	hsa-miR-451a	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	32989397
MIRT714013	hsa-miR-548at-3p	HITS-CLIP	19536157
MIRT714012	hsa-miR-548ay-3p	HITS-CLIP	19536157
MIRT714011	hsa-miR-1537-3p	HITS-CLIP	19536157
MIRT054843	hsa-miR-451a	HITS-CLIP	19536157
MIRT714010	hsa-miR-5197-5p	HITS-CLIP	19536157
MIRT714009	hsa-miR-5680	HITS-CLIP	19536157
MIRT714008	hsa-miR-4330	HITS-CLIP	19536157
MIRT714007	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT714006	hsa-miR-2052	HITS-CLIP	19536157
MIRT714005	hsa-miR-7641	HITS-CLIP	19536157
MIRT687901	hsa-miR-4418	HITS-CLIP	23313552
MIRT687900	hsa-miR-509-3-5p	HITS-CLIP	23313552
MIRT687899	hsa-miR-509-5p	HITS-CLIP	23313552
MIRT687898	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT687897	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT687896	hsa-miR-1915-3p	HITS-CLIP	23313552
MIRT687895	hsa-miR-6764-5p	HITS-CLIP	23313552
MIRT687894	hsa-miR-4726-3p	HITS-CLIP	23313552
MIRT687893	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT687892	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT687891	hsa-miR-1307-3p	HITS-CLIP	23313552
MIRT687890	hsa-miR-4638-5p	HITS-CLIP	23313552
MIRT687889	hsa-miR-1184	HITS-CLIP	23313552
MIRT687888	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687887	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687886	hsa-miR-4284	HITS-CLIP	23313552
MIRT687885	hsa-miR-192-5p	HITS-CLIP	23313552
MIRT687884	hsa-miR-215-5p	HITS-CLIP	23313552
MIRT687883	hsa-miR-7156-3p	HITS-CLIP	23313552
MIRT646824	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT646823	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT646822	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT646821	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT646820	hsa-miR-5096	HITS-CLIP	23824327
MIRT646819	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT523017	hsa-miR-4438	PAR-CLIP	23446348
MIRT523016	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT523015	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT523014	hsa-miR-4722-3p	PAR-CLIP	23446348
MIRT523013	hsa-miR-6727-3p	PAR-CLIP	23446348
MIRT523012	hsa-miR-6747-3p	PAR-CLIP	23446348
MIRT523011	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT523010	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT523008	hsa-miR-5095	PAR-CLIP	23446348
MIRT523009	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT523007	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT523006	hsa-miR-3619-3p	PAR-CLIP	23446348
MIRT523005	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT1065000	hsa-let-7a	CLIP-seq
MIRT1065001	hsa-let-7b	CLIP-seq
MIRT1065002	hsa-let-7c	CLIP-seq
MIRT1065003	hsa-let-7d	CLIP-seq
MIRT1065004	hsa-let-7e	CLIP-seq
MIRT1065005	hsa-let-7f	CLIP-seq
MIRT1065006	hsa-let-7g	CLIP-seq
MIRT1065007	hsa-let-7i	CLIP-seq
MIRT1065008	hsa-miR-106a	CLIP-seq
MIRT1065009	hsa-miR-106b	CLIP-seq
MIRT1065010	hsa-miR-1183	CLIP-seq
MIRT1065011	hsa-miR-1200	CLIP-seq
MIRT1065012	hsa-miR-1207-5p	CLIP-seq
MIRT1065013	hsa-miR-122	CLIP-seq
MIRT1065014	hsa-miR-1224-3p	CLIP-seq
MIRT1065015	hsa-miR-1236	CLIP-seq
MIRT1065016	hsa-miR-1245	CLIP-seq
MIRT1065017	hsa-miR-125a-5p	CLIP-seq
MIRT1065018	hsa-miR-125b	CLIP-seq
MIRT1065019	hsa-miR-1260	CLIP-seq
MIRT1065020	hsa-miR-1260b	CLIP-seq
MIRT1065021	hsa-miR-1267	CLIP-seq
MIRT1065022	hsa-miR-1277	CLIP-seq
MIRT1065023	hsa-miR-1280	CLIP-seq
MIRT1065024	hsa-miR-1290	CLIP-seq
MIRT1065025	hsa-miR-1291	CLIP-seq
MIRT1065026	hsa-miR-1299	CLIP-seq
MIRT1065027	hsa-miR-1307	CLIP-seq
MIRT1065028	hsa-miR-136	CLIP-seq
MIRT1065029	hsa-miR-150	CLIP-seq
MIRT1065030	hsa-miR-17	CLIP-seq
MIRT1065031	hsa-miR-202	CLIP-seq
MIRT1065032	hsa-miR-2053	CLIP-seq
MIRT1065033	hsa-miR-20a	CLIP-seq
MIRT1065034	hsa-miR-20b	CLIP-seq
MIRT1065035	hsa-miR-214	CLIP-seq
MIRT1065036	hsa-miR-219-1-3p	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT1065040	hsa-miR-302a	CLIP-seq
MIRT1065041	hsa-miR-302b	CLIP-seq
MIRT1065042	hsa-miR-302c	CLIP-seq
MIRT1065043	hsa-miR-302d	CLIP-seq
MIRT1065044	hsa-miR-302e	CLIP-seq
MIRT1065045	hsa-miR-3126-3p	CLIP-seq
MIRT1065046	hsa-miR-3135b	CLIP-seq
MIRT1065047	hsa-miR-3144-5p	CLIP-seq
MIRT1065048	hsa-miR-3160-5p	CLIP-seq
MIRT1065049	hsa-miR-3167	CLIP-seq
MIRT1065050	hsa-miR-3191	CLIP-seq
MIRT1065051	hsa-miR-3194-3p	CLIP-seq
MIRT1065052	hsa-miR-323b-3p	CLIP-seq
MIRT1065053	hsa-miR-3619-5p	CLIP-seq
MIRT1065054	hsa-miR-3652	CLIP-seq
MIRT1065055	hsa-miR-3670	CLIP-seq
MIRT1065056	hsa-miR-3714	CLIP-seq
MIRT1065057	hsa-miR-371-5p	CLIP-seq
MIRT1065058	hsa-miR-371b-5p	CLIP-seq
MIRT1065059	hsa-miR-372	CLIP-seq
MIRT1065060	hsa-miR-373	CLIP-seq
MIRT1065061	hsa-miR-378	CLIP-seq
MIRT1065062	hsa-miR-378b	CLIP-seq
MIRT1065063	hsa-miR-378c	CLIP-seq
MIRT1065064	hsa-miR-378d	CLIP-seq
MIRT1065065	hsa-miR-378e	CLIP-seq
MIRT1065066	hsa-miR-378f	CLIP-seq
MIRT1065067	hsa-miR-378h	CLIP-seq
MIRT1065068	hsa-miR-378i	CLIP-seq
MIRT1065069	hsa-miR-3913-3p	CLIP-seq
MIRT1065070	hsa-miR-3922-5p	CLIP-seq
MIRT1065071	hsa-miR-3974	CLIP-seq
MIRT1065072	hsa-miR-422a	CLIP-seq
MIRT1065073	hsa-miR-4286	CLIP-seq
MIRT1065074	hsa-miR-4310	CLIP-seq
MIRT1065075	hsa-miR-4312	CLIP-seq
MIRT1065076	hsa-miR-4319	CLIP-seq
MIRT1065077	hsa-miR-4324	CLIP-seq
MIRT1065078	hsa-miR-4430	CLIP-seq
MIRT1065079	hsa-miR-4504	CLIP-seq
MIRT1065080	hsa-miR-4638-3p	CLIP-seq
MIRT1065081	hsa-miR-4652-3p	CLIP-seq
MIRT1065082	hsa-miR-4652-5p	CLIP-seq
MIRT1065083	hsa-miR-4667-5p	CLIP-seq
MIRT1065084	hsa-miR-4668-5p	CLIP-seq
MIRT1065085	hsa-miR-4691-5p	CLIP-seq
MIRT1065086	hsa-miR-4700-5p	CLIP-seq
MIRT1065087	hsa-miR-4731-5p	CLIP-seq
MIRT1065088	hsa-miR-4736	CLIP-seq
MIRT1065089	hsa-miR-4742-3p	CLIP-seq
MIRT1065090	hsa-miR-4757-5p	CLIP-seq
MIRT1065091	hsa-miR-4763-3p	CLIP-seq
MIRT1065092	hsa-miR-4778-5p	CLIP-seq
MIRT1065093	hsa-miR-4782-5p	CLIP-seq
MIRT1065094	hsa-miR-516b	CLIP-seq
MIRT1065095	hsa-miR-519d	CLIP-seq
MIRT1065096	hsa-miR-520a-3p	CLIP-seq
MIRT1065097	hsa-miR-520b	CLIP-seq
MIRT1065098	hsa-miR-520c-3p	CLIP-seq
MIRT1065099	hsa-miR-520d-3p	CLIP-seq
MIRT1065100	hsa-miR-520e	CLIP-seq
MIRT1065101	hsa-miR-520g	CLIP-seq
MIRT1065102	hsa-miR-520h	CLIP-seq
MIRT1065103	hsa-miR-532-3p	CLIP-seq
MIRT1065104	hsa-miR-542-3p	CLIP-seq
MIRT1065105	hsa-miR-544b	CLIP-seq
MIRT1065106	hsa-miR-548ad	CLIP-seq
MIRT1065107	hsa-miR-556-5p	CLIP-seq
MIRT1065108	hsa-miR-569	CLIP-seq
MIRT1065109	hsa-miR-570	CLIP-seq
MIRT1065110	hsa-miR-576-3p	CLIP-seq
MIRT1065111	hsa-miR-610	CLIP-seq
MIRT1065112	hsa-miR-653	CLIP-seq
MIRT1065113	hsa-miR-758	CLIP-seq
MIRT1065114	hsa-miR-761	CLIP-seq
MIRT1065115	hsa-miR-876-5p	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT1065117	hsa-miR-93	CLIP-seq
MIRT1065118	hsa-miR-98	CLIP-seq
MIRT1550133	hsa-miR-4433	CLIP-seq
MIRT2015487	hsa-miR-1273d	CLIP-seq
MIRT2015488	hsa-miR-1285	CLIP-seq
MIRT2015489	hsa-miR-1321	CLIP-seq
MIRT2015490	hsa-miR-149	CLIP-seq
MIRT1065036	hsa-miR-219-1-3p	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT2015491	hsa-miR-3064-5p	CLIP-seq
MIRT2015492	hsa-miR-3120-5p	CLIP-seq
MIRT2015493	hsa-miR-3158-5p	CLIP-seq
MIRT2015494	hsa-miR-3187-5p	CLIP-seq
MIRT2015495	hsa-miR-34a	CLIP-seq
MIRT2015496	hsa-miR-3945	CLIP-seq
MIRT2015497	hsa-miR-3978	CLIP-seq
MIRT2015498	hsa-miR-4253	CLIP-seq
MIRT1065077	hsa-miR-4324	CLIP-seq
MIRT2015499	hsa-miR-4446-5p	CLIP-seq
MIRT2015500	hsa-miR-4464	CLIP-seq
MIRT2015501	hsa-miR-449a	CLIP-seq
MIRT2015502	hsa-miR-449b	CLIP-seq
MIRT2015503	hsa-miR-4694-3p	CLIP-seq
MIRT2015504	hsa-miR-4739	CLIP-seq
MIRT2015505	hsa-miR-4748	CLIP-seq
MIRT2015506	hsa-miR-4755-5p	CLIP-seq
MIRT2015507	hsa-miR-4756-5p	CLIP-seq
MIRT2015508	hsa-miR-4794	CLIP-seq
MIRT2015509	hsa-miR-522	CLIP-seq
MIRT1065109	hsa-miR-570	CLIP-seq
MIRT2015510	hsa-miR-593	CLIP-seq
MIRT2015511	hsa-miR-612	CLIP-seq
MIRT2015512	hsa-miR-642b	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT1065011	hsa-miR-1200	CLIP-seq
MIRT2247764	hsa-miR-1207-3p	CLIP-seq
MIRT1065014	hsa-miR-1224-3p	CLIP-seq
MIRT1065016	hsa-miR-1245	CLIP-seq
MIRT1065017	hsa-miR-125a-5p	CLIP-seq
MIRT1065018	hsa-miR-125b	CLIP-seq
MIRT1065019	hsa-miR-1260	CLIP-seq
MIRT1065020	hsa-miR-1260b	CLIP-seq
MIRT2247765	hsa-miR-1270	CLIP-seq
MIRT2015487	hsa-miR-1273d	CLIP-seq
MIRT2247766	hsa-miR-128	CLIP-seq
MIRT1065023	hsa-miR-1280	CLIP-seq
MIRT1065024	hsa-miR-1290	CLIP-seq
MIRT1065025	hsa-miR-1291	CLIP-seq
MIRT2247767	hsa-miR-132	CLIP-seq
MIRT1065028	hsa-miR-136	CLIP-seq
MIRT2247768	hsa-miR-142-5p	CLIP-seq
MIRT1065029	hsa-miR-150	CLIP-seq
MIRT2247769	hsa-miR-182	CLIP-seq
MIRT2247770	hsa-miR-186	CLIP-seq
MIRT2247771	hsa-miR-1913	CLIP-seq
MIRT2247772	hsa-miR-1915	CLIP-seq
MIRT2247773	hsa-miR-192	CLIP-seq
MIRT2247774	hsa-miR-1976	CLIP-seq
MIRT2247775	hsa-miR-212	CLIP-seq
MIRT1065035	hsa-miR-214	CLIP-seq
MIRT2247776	hsa-miR-215	CLIP-seq
MIRT1065036	hsa-miR-219-1-3p	CLIP-seq
MIRT2247777	hsa-miR-22	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT2247778	hsa-miR-27a	CLIP-seq
MIRT2247779	hsa-miR-27b	CLIP-seq
MIRT2247780	hsa-miR-299-3p	CLIP-seq
MIRT2247781	hsa-miR-3121-5p	CLIP-seq
MIRT2247782	hsa-miR-3133	CLIP-seq
MIRT2247783	hsa-miR-3135	CLIP-seq
MIRT2247784	hsa-miR-3136-3p	CLIP-seq
MIRT2247785	hsa-miR-3152-5p	CLIP-seq
MIRT2247786	hsa-miR-3155	CLIP-seq
MIRT2247787	hsa-miR-3155b	CLIP-seq
MIRT2015493	hsa-miR-3158-5p	CLIP-seq
MIRT1065048	hsa-miR-3160-5p	CLIP-seq
MIRT1065049	hsa-miR-3167	CLIP-seq
MIRT2247788	hsa-miR-3189-5p	CLIP-seq
MIRT2247789	hsa-miR-320a	CLIP-seq
MIRT2247790	hsa-miR-320b	CLIP-seq
MIRT2247791	hsa-miR-320c	CLIP-seq
MIRT2247792	hsa-miR-320d	CLIP-seq
MIRT2247793	hsa-miR-320e	CLIP-seq
MIRT2247794	hsa-miR-323-3p	CLIP-seq
MIRT2247795	hsa-miR-324-3p	CLIP-seq
MIRT2247796	hsa-miR-330-3p	CLIP-seq
MIRT2247797	hsa-miR-335	CLIP-seq
MIRT2247798	hsa-miR-338-3p	CLIP-seq
MIRT2247799	hsa-miR-340	CLIP-seq
MIRT2015495	hsa-miR-34a	CLIP-seq
MIRT2247800	hsa-miR-3591-3p	CLIP-seq
MIRT2247801	hsa-miR-3617	CLIP-seq
MIRT1065053	hsa-miR-3619-5p	CLIP-seq
MIRT1065055	hsa-miR-3670	CLIP-seq
MIRT2247802	hsa-miR-3677-5p	CLIP-seq
MIRT1065069	hsa-miR-3913-3p	CLIP-seq
MIRT2247803	hsa-miR-3943	CLIP-seq
MIRT2247804	hsa-miR-4291	CLIP-seq
MIRT1065076	hsa-miR-4319	CLIP-seq
MIRT1065077	hsa-miR-4324	CLIP-seq
MIRT2247805	hsa-miR-4423-5p	CLIP-seq
MIRT2247806	hsa-miR-4429	CLIP-seq
MIRT2015501	hsa-miR-449a	CLIP-seq
MIRT2015502	hsa-miR-449b	CLIP-seq
MIRT2247807	hsa-miR-4531	CLIP-seq
MIRT2247808	hsa-miR-4646-5p	CLIP-seq
MIRT2247809	hsa-miR-4659a-3p	CLIP-seq
MIRT2247810	hsa-miR-4659b-3p	CLIP-seq
MIRT2247811	hsa-miR-4683	CLIP-seq
MIRT2247812	hsa-miR-4690-3p	CLIP-seq
MIRT2247813	hsa-miR-4725-5p	CLIP-seq
MIRT2247814	hsa-miR-4727-5p	CLIP-seq
MIRT2247815	hsa-miR-4729	CLIP-seq
MIRT1065089	hsa-miR-4742-3p	CLIP-seq
MIRT2247816	hsa-miR-4747-5p	CLIP-seq
MIRT1065090	hsa-miR-4757-5p	CLIP-seq
MIRT2247817	hsa-miR-4758-3p	CLIP-seq
MIRT1065093	hsa-miR-4782-5p	CLIP-seq
MIRT2247818	hsa-miR-484	CLIP-seq
MIRT2247819	hsa-miR-504	CLIP-seq
MIRT2247820	hsa-miR-513a-5p	CLIP-seq
MIRT2247821	hsa-miR-513c	CLIP-seq
MIRT2247822	hsa-miR-514b-5p	CLIP-seq
MIRT1065103	hsa-miR-532-3p	CLIP-seq
MIRT2247823	hsa-miR-543	CLIP-seq
MIRT1065106	hsa-miR-548ad	CLIP-seq
MIRT2247824	hsa-miR-553	CLIP-seq
MIRT2247825	hsa-miR-555	CLIP-seq
MIRT1065109	hsa-miR-570	CLIP-seq
MIRT2247826	hsa-miR-572	CLIP-seq
MIRT1065110	hsa-miR-576-3p	CLIP-seq
MIRT2247827	hsa-miR-579	CLIP-seq
MIRT2247828	hsa-miR-620	CLIP-seq
MIRT2247829	hsa-miR-621	CLIP-seq
MIRT2247830	hsa-miR-641	CLIP-seq
MIRT2247831	hsa-miR-646	CLIP-seq
MIRT2247832	hsa-miR-663b	CLIP-seq
MIRT2247833	hsa-miR-7	CLIP-seq
MIRT1065114	hsa-miR-761	CLIP-seq
MIRT1065115	hsa-miR-876-5p	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT2247834	hsa-miR-922	CLIP-seq
MIRT2247803	hsa-miR-3943	CLIP-seq
MIRT2247812	hsa-miR-4690-3p	CLIP-seq
MIRT2247781	hsa-miR-3121-5p	CLIP-seq
MIRT2247788	hsa-miR-3189-5p	CLIP-seq
MIRT1065069	hsa-miR-3913-3p	CLIP-seq
MIRT2247813	hsa-miR-4725-5p	CLIP-seq
MIRT2247817	hsa-miR-4758-3p	CLIP-seq
MIRT2247819	hsa-miR-504	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT2451784	hsa-miR-10a	CLIP-seq
MIRT2451785	hsa-miR-10b	CLIP-seq
MIRT2451786	hsa-miR-1283	CLIP-seq
MIRT2451787	hsa-miR-339-5p	CLIP-seq
MIRT2451788	hsa-miR-4421	CLIP-seq
MIRT2451789	hsa-miR-4684-5p	CLIP-seq
MIRT2015510	hsa-miR-593	CLIP-seq
MIRT1065013	hsa-miR-122	CLIP-seq
MIRT1065024	hsa-miR-1290	CLIP-seq
MIRT1065027	hsa-miR-1307	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT1065046	hsa-miR-3135b	CLIP-seq
MIRT1065049	hsa-miR-3167	CLIP-seq
MIRT1065054	hsa-miR-3652	CLIP-seq
MIRT1065078	hsa-miR-4430	CLIP-seq
MIRT1065093	hsa-miR-4782-5p	CLIP-seq
MIRT2247826	hsa-miR-572	CLIP-seq
MIRT2247829	hsa-miR-621	CLIP-seq
MIRT1065115	hsa-miR-876-5p	CLIP-seq
MIRT2247780	hsa-miR-299-3p	CLIP-seq
MIRT2247800	hsa-miR-3591-3p	CLIP-seq
MIRT2247825	hsa-miR-555	CLIP-seq
MIRT2682802	hsa-miR-656	CLIP-seq
MIRT2682803	hsa-miR-889	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PPARA	Repression	14764586

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002384	Process	Hepatic immune response	TAS	12832423
GO:0002446	Process	Neutrophil mediated immunity	TAS	16034137
GO:0002548	Process	Monocyte chemotaxis	IC	10510402
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	TAS	15100312, 16034137
GO:0004896	Function	Cytokine receptor activity	IDA	12829785
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004897	Function	Ciliary neurotrophic factor receptor activity	IMP	12643274
GO:0004915	Function	Interleukin-6 receptor activity	IDA	2261637
GO:0004915	Function	Interleukin-6 receptor activity	IEA
GO:0004921	Function	Interleukin-11 receptor activity	IBA
GO:0005138	Function	Interleukin-6 receptor binding	IPI	12829785
GO:0005515	Function	Protein binding	IPI	8702737, 11238858, 12829785, 16034137, 18775332, 25009770, 28265003, 32296183
GO:0005576	Component	Extracellular region	IDA	12748171
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	21990364
GO:0005615	Component	Extracellular space	IDA	12419823, 15579373, 16034137
GO:0005886	Component	Plasma membrane	IDA	12829785
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005896	Component	Interleukin-6 receptor complex	IDA	2261637, 12829785
GO:0005896	Component	Interleukin-6 receptor complex	IEA
GO:0006953	Process	Acute-phase response	TAS	12832423
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2261637
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18719127
GO:0009897	Component	External side of plasma membrane	IBA
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	16034137
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	2261637
GO:0019899	Function	Enzyme binding	IPI	12748171
GO:0019970	Function	Interleukin-11 binding	IBA
GO:0019981	Function	Interleukin-6 binding	IBA
GO:0019981	Function	Interleukin-6 binding	IEA
GO:0019981	Function	Interleukin-6 binding	IPI	12829785
GO:0031018	Process	Endocrine pancreas development	IC	18719127
GO:0031018	Process	Endocrine pancreas development	IMP	18719127
GO:0032502	Process	Developmental process	IEA
GO:0032717	Process	Negative regulation of interleukin-8 production	NAS	16034137
GO:0032722	Process	Positive regulation of chemokine production	IDA	10510402
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	10510402
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IDA	12419823
GO:0034097	Process	Response to cytokine	IDA	2261637
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12633863
GO:0043235	Component	Receptor complex	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12419823
GO:0045669	Process	Positive regulation of osteoblast differentiation	TAS	12372336
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	10510402
GO:0050829	Process	Defense response to Gram-negative bacterium	TAS	16034137
GO:0050830	Process	Defense response to Gram-positive bacterium	NAS	16034137
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IBA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873, 12829785
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	11884403, 12829785, 31145836
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	12643274
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070110	Component	Ciliary neurotrophic factor receptor complex	IDA	12643274
GO:0070119	Function	Ciliary neurotrophic factor binding	IPI	12643274
GO:0070120	Process	Ciliary neurotrophic factor-mediated signaling pathway	IMP	12643274
GO:0072126	Process	Positive regulation of glomerular mesangial cell proliferation	IMP	26563755
GO:0072540	Process	T-helper 17 cell lineage commitment	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	15100312
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IMP	12643274
GO:1901731	Process	Positive regulation of platelet aggregation	IDA	31145836

Other IDs

• MIM: 147880
• HGNC: 6019
• e!Ensembl: ENSG00000160712

Protein

• UniProt ID: P08887
• Protein name: Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]
• Protein function: Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal (PubMed:28265003). Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-
• PDB: 1N26, 1P9M, 2ARW, 5FUC, 7DC8, 8D82, 8IOW, 8QY5, 8QY6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	30 → 101	Immunoglobulin domain	Domain
  PF09240	IL6Ra-bind	118 → 213	Interleukin-6 receptor alpha chain, binding	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 2]: Expressed in peripheral blood mononuclear cells and weakly found in urine and serum. 1%-20% of the total sIL6R in plasma is generated by alternative splicing (PubMed:28060820). {ECO:0000269|PubMed:28060820}.
• Sequence:

  MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
  VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
  CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
  PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
  PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
  GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
  SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
  TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR

• Sequence length: 468

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
HIF-1 signaling pathway
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Hematopoietic cell lineage
Th17 cell differentiation
Non-alcoholic fatty liver disease
Human cytomegalovirus infection
Coronavirus disease - COVID-19
Pathways in cancer

Reactome:

Interleukin-6 signaling
MAPK3 (ERK1) activation
MAPK1 (ERK2) activation
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE COMBINED IMMUNODEFICIENCY DUE TO IL6R DEFICIENCY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HASHIMOTO DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyper-IgE recurrent infection syndrome 5, autosomal recessive	Uncertain significance; no classifications from unflagged records	ClinVar ClinGen, ClinVar, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPER-IGE SYNDROME 5, AUTOSOMAL RECESSIVE, WITH RECURRENT INFECTIONS	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL6R-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interleukin 6, serum level of, quantitative trait locus	Benign	ClinVar ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Soluble interleukin-6 receptor, serum level of, quantitative trait locus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	25619282		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	1290964		★☆☆☆☆ Found in Text Mining only
Acute necrotizing encephalopathy	Necrotizing Encephalopathy	BEFREE	31201070		★☆☆☆☆ Found in Text Mining only
Acute necrotizing encephalopathy of childhood	Necrotizing Encephalopathy	BEFREE	31201070		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	25856562		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	9824498		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26626881, 28650998, 36810164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	25340798		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31118040, 31611269, 34075589	Associate	★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	LHGDN	18784373		★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	23372742, 23378927, 30314457		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	37932834	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	23749187, 26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28611107		★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	40287692	Associate	★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	GWASCAT_DG	25200001		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety disorder	Pubtator	32769481	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	30090940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic aneurysm	Pubtator	30090940	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	23593036, 29507647, 37893562, 40008516	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	29158612	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	23593036, 30657332		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	GWASCAT_DG	27899403		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Ruptured	Aortic Aneurysm	BEFREE	30657332		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	24717336		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	26714766		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	26714766	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21835044, 24717336		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	28276471	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29079714, 29631459, 30025850		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	32730263	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11208277, 23379428, 23593036, 24668548, 24791950, 25016825, 25345743, 25888920, 26336855, 28659662, 30518408, 31483954, 33054050, 34931349, 37796367, 38001504	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	26152611		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19503017, 21907864, 22554704, 23593036, 23945879, 24668548, 24791950, 25390970, 31101830, 38302925	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	21907864, 22554704, 23593036, 23945879, 26932604, 26997259, 28334838, 31101830, 31223480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	21907864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	21907864, 29273806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	29902480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	21835044, 24717336		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21835044, 38104193, 39216780	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	21846873, 23593036, 24239840, 24940886, 30203815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	21846873, 23593036, 24239840, 24940886, 30203815, 34931349, 35292824, 36253349	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	37581400	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	LHGDN	18490707		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18490707, 25345743, 33590853, 34506050	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31633019		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	7512667		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	40710309	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21523452, 24670917, 28255366, 29557068		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24670917, 27460086, 31795965, 36922677	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25409741		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9163607	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29258522	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	7512667		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16425355, 22942733, 24668548, 32792856, 34053234	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22552503, 25461668, 26744530, 28981818, 30132982, 30216513		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27825119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18384626, 26554658, 9462266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	8263017	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24388871, 25658637, 29576612, 31448054		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21981268, 27062409, 28334838, 28465139, 30090940, 30175897, 31707836, 31836512		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30090940, 31707836, 32769481, 34931349, 35948913, 36441964, 39271913	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21393601, 33350884	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	25813875		★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	23372742, 34431136	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37694725	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19280716		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	30836997	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26955245, 34931349	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	15456942		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31679401		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	33350884	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28741286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	28741286		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10869285, 25041016, 30419338		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30419338	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	25524550		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30623437, 8547132		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28334838		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	23433353		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26284520	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26673628	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26091352, 31668584		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15284182		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22674296	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29068474, 31668584, 34931923	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31297975		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19567438, 22421339, 22421340, 23073775, 24971337, 25781951, 30090940		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19567438, 22421339, 22421340, 22902153, 23073775, 24717336, 24971337, 25781951, 27062409, 30090940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	24699044, 34931349, 35452290, 35604899, 40649979	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975, 29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1	Coronary artery disease	GWASDB_DG	23202125		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19567438, 23593036, 24791950, 25781951, 30090940, 39271913	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19567438, 22421339, 22421340, 23073775, 23593036, 24971337, 25781951, 30090940, 31812227		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	22319020		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	22319020		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	28487953, 28859336	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31219357		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24668548, 24971461	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24971461, 29775600		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25846075, 29755657		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	21851175		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26725994		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	21496483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	29197507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	33901562	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	23582566, 31707051		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	26482879		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17898129, 18852330, 28769070		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17898129, 18852330, 28769070		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18852330, 31864032, 38241313	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23593036, 24791950, 27629486	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19633828, 22761857	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31237452	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18853133, 22642608		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15561970, 15562008, 17570254, 17898129, 22642608		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26563755	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15562008		★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	31158415, 31165501		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	22128229	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	21835044, 25524550		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	21835044, 38001504	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	23582566, 31707051		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GENOMICS_ENGLAND_DG	31235509		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26130650		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28779573	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24388871, 29576612, 31448054		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	BEFREE	30457413		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	27871023		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	32636303	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30419338		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	30105789	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	19965620	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	27998620, 28431111, 28745999		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	30090940, 36597161	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30467961	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29258522	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29510423		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	29513361	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29691471		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	16372246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	11511426, 39271913	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31297975		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	24498998		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11468177, 1710152	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1710152		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	12917504		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	12917504	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	LHGDN	12414855		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32028672	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29629897, 29629898		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27317687		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26284520		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10530495, 29775600		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24971461, 28276471	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19633828	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23771909	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33166496, 36081453	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26782593, 26955245, 31836512		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	26305060, 27166661, 28861079, 29654485		★☆☆☆☆ Found in Text Mining only
Juvenile pauciarticular chronic arthritis	Pauciarticular chronic arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1700730, 7919380, 9092685	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32349161, 7919380	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28967792		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	28776758		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1321738, 23954788, 24668548, 27477312, 30224299		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26336855	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19438606	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	19438606	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1321738		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11208277, 1563109, 25345743, 8881918	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11208277, 23594084, 8881918		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37329186	Associate	★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	28520640		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	28520640		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31100612		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21523452, 24670917, 28255366, 29557068		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26130650		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22552503, 25461668, 26744530, 28981818, 30132982, 30216513		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25658637		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	2004327		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21145125, 22552503, 28707587, 29777792, 8547132		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28741286		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	23078005		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23078005	Associate	★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	18439548		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18781131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	18781131	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	21496483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	29197507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic syndrome	Pubtator	12917504	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18439548, 20186139, 23479153, 23771909, 34931349	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	16817825, 20186139, 23094986, 23479153, 31836512		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29191973		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	15674420		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	24032723		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	28540748		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	34135474	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25973020	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10460618, 11532348, 1587349, 28540748, 31413087, 31773675, 7619053, 7989587		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10460618, 10772337, 11090073, 11485567, 11532348, 11754398, 11886382, 14592826, 1587349, 16234364, 16892169, 17003370, 18635812, 19124510, 19228610, 19713220, 21220034, 22072558, 31413087, 31773675, 35642704, 7619053, 7949175, 8547658, 9022078, 9490667, 9734662	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12574959		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14695887	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12445803		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37175706	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25781951, 28144260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	26343387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	31707836, 39271913	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	19497133, 24531711, 26130650, 26255282, 26892443, 27658435, 28255366, 28611107, 30098545, 30224299, 30419338, 31773675, 9891500		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	14686749	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8392518		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28276471	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31683232		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28967792		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	22552503		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30132982, 31232177		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29197507		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12917504, 14680981, 15561970, 16817825, 17570254, 22642608, 24681566, 28683285, 29024103, 30224299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	12917504, 22228719, 26200663, 27907186, 31668584	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	22761857	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	GWASCAT_DG	23603761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	37140355	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	15995586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	15995586		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	15995586		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11089884, 29117539, 30098545		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24854843, 35166635	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37774081	Stimulate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	LHGDN	17908769		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25658637, 26255282		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19088723, 25658637, 27825119, 31918995	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28611107		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12553038		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31685825	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	33893003	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	9824498	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32884248, 34191436	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	16899024		★☆☆☆☆ Found in Text Mining only
Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative	Seronegative polyarthritis	GWASCAT_DG	23603761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	40181376, 40287692	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	15995586		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	26725994		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	9891500		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21837779		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26499200, 27344294, 35465350, 35703345	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychomotor Disorders	Psychiatric disorders	Pubtator	29510423	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	24743863	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29197507		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29629897		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	29629898	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25183374, 27078193, 27561911	Associate	★☆☆☆☆ Found in Text Mining only
Pycnodysostosis	Pycnodysostosis	BEFREE	7663521, 8698329		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	25619282		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	35452290, 39266570	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11208277, 12794819, 19713205, 20551110, 20661738, 21412181, 21981268, 22421340, 22467923, 23593036, 24449571, 24978393, 26177310, 26336855, 27599663, 27722854, 27733490, 27958380, 28316139, 28516886, 28516890, 29334721, 29570475, 29755657, 30175897, 30852105, 30859382, 30899276, 31801637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	16729287, 23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	23143596, 24390342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	23143596, 24390342, 24532676, 30423114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	7834629		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	18508242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24743863, 28974776	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	26198920, 26481614, 28974776		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	8067274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	33182754	Associate	★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	29197507		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	40298889	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	38346238	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16432158		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31328584		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	34008757	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12760309, 20698883, 24886605, 27824145, 34008757	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	34931349, 36253349	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29429002		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	29570475		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22742541		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	27515155, 29191819, 31297975, 31388749		★☆☆☆☆ Found in Text Mining only
Thrombophilia due to Activated Protein C Resistance	Thrombophilia	Pubtator	28540748	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	30081019, 31338585		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34730199	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	LHGDN	12553555		★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	31158415, 31165501		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24971461, 29775600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	31100612		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30744595	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10925276	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	25200001	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28769070		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	38565387	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	35625609	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	30279229	Associate	★☆☆☆☆ Found in Text Mining only