IL4R (interleukin 4 receptor)

Gene

• Entrez ID: 3566
• Gene name: Interleukin 4 receptor
• Gene symbol: IL4R
• Synonyms (NCBI Gene): CD124, IL-4RA, IL4RA
• Chromosome: 16
• Chromosome location: 16p12.1
• Summary: This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 ce

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1801275	A>G	Risk-factor	Downstream transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs1805010	A>C,G,T	Protective, pathogenic	Missense variant, synonymous variant, genic upstream transcript variant, 5 prime UTR variant, coding sequence variant
rs6413500	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	3 prime UTR variant, missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043562	hsa-miR-331-3p	CLASH	23622248
MIRT497252	hsa-miR-4724-5p	PAR-CLIP	22291592
MIRT497251	hsa-miR-4780	PAR-CLIP	22291592
MIRT497250	hsa-miR-2277-3p	PAR-CLIP	22291592
MIRT497252	hsa-miR-4724-5p	PAR-CLIP	22291592
MIRT497251	hsa-miR-4780	PAR-CLIP	22291592
MIRT497250	hsa-miR-2277-3p	PAR-CLIP	22291592
MIRT1064987	hsa-miR-1267	CLIP-seq
MIRT1064988	hsa-miR-3908	CLIP-seq
MIRT1064989	hsa-miR-3909	CLIP-seq
MIRT1064990	hsa-miR-3942-5p	CLIP-seq
MIRT1064991	hsa-miR-4703-5p	CLIP-seq
MIRT1064992	hsa-miR-4766-3p	CLIP-seq
MIRT1064993	hsa-miR-622	CLIP-seq
MIRT1064994	hsa-miR-935	CLIP-seq
MIRT2015444	hsa-miR-125a-5p	CLIP-seq
MIRT2015445	hsa-miR-125b	CLIP-seq
MIRT2015446	hsa-miR-1264	CLIP-seq
MIRT2015447	hsa-miR-1285	CLIP-seq
MIRT2015448	hsa-miR-1297	CLIP-seq
MIRT2015449	hsa-miR-1827	CLIP-seq
MIRT2015450	hsa-miR-1909	CLIP-seq
MIRT2015451	hsa-miR-205	CLIP-seq
MIRT2015452	hsa-miR-26a	CLIP-seq
MIRT2015453	hsa-miR-26b	CLIP-seq
MIRT2015454	hsa-miR-2861	CLIP-seq
MIRT2015455	hsa-miR-3127-3p	CLIP-seq
MIRT2015456	hsa-miR-3151	CLIP-seq
MIRT2015457	hsa-miR-3187-5p	CLIP-seq
MIRT2015458	hsa-miR-3665	CLIP-seq
MIRT2015459	hsa-miR-378g	CLIP-seq
MIRT2015460	hsa-miR-3978	CLIP-seq
MIRT2015461	hsa-miR-4297	CLIP-seq
MIRT2015462	hsa-miR-4319	CLIP-seq
MIRT2015463	hsa-miR-4465	CLIP-seq
MIRT2015464	hsa-miR-4486	CLIP-seq
MIRT2015465	hsa-miR-4640-5p	CLIP-seq
MIRT2015466	hsa-miR-4670-3p	CLIP-seq
MIRT2015467	hsa-miR-4697-3p	CLIP-seq
MIRT2015468	hsa-miR-4705	CLIP-seq
MIRT2015469	hsa-miR-4726-5p	CLIP-seq
MIRT2015470	hsa-miR-4732-3p	CLIP-seq
MIRT2015471	hsa-miR-4736	CLIP-seq
MIRT2015472	hsa-miR-4771	CLIP-seq
MIRT2015473	hsa-miR-485-3p	CLIP-seq
MIRT2015474	hsa-miR-512-5p	CLIP-seq
MIRT2015475	hsa-miR-541	CLIP-seq
MIRT2015476	hsa-miR-545	CLIP-seq
MIRT2015477	hsa-miR-612	CLIP-seq
MIRT2015478	hsa-miR-654-5p	CLIP-seq
MIRT2015479	hsa-miR-670	CLIP-seq
MIRT2015480	hsa-miR-940	CLIP-seq
MIRT2015444	hsa-miR-125a-5p	CLIP-seq
MIRT2015445	hsa-miR-125b	CLIP-seq
MIRT2015462	hsa-miR-4319	CLIP-seq
MIRT2015470	hsa-miR-4732-3p	CLIP-seq
MIRT2451783	hsa-miR-645	CLIP-seq
MIRT2015479	hsa-miR-670	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004913	Function	Interleukin-4 receptor activity	IBA
GO:0004913	Function	Interleukin-4 receptor activity	IDA	10219247
GO:0004913	Function	Interleukin-4 receptor activity	TAS	2307934
GO:0005515	Function	Protein binding	IPI	8266078, 8816495, 9392697, 9651359, 10219247, 18243101, 23597562
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	23321270
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2307934
GO:0006955	Process	Immune response	TAS	2307934
GO:0007165	Process	Signal transduction	TAS	2307934
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IBA
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IDA	7760829, 7929391, 17200144
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IDA	10219247
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043306	Process	Positive regulation of mast cell degranulation	IEA
GO:0045063	Process	T-helper 1 cell differentiation	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045626	Process	Negative regulation of T-helper 1 cell differentiation	IEA
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24906148
GO:1901741	Process	Positive regulation of myoblast fusion	IEA

Other IDs

• MIM: 147781
• HGNC: 6015
• e!Ensembl: ENSG00000077238

Protein

• UniProt ID: P24394
• Protein name: Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL
• Protein function: Receptor for both interleukin 4 and interleukin 13 (PubMed:17030238). Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, che
• PDB: 1IAR, 1IRS, 3BPL, 3BPN, 3BPO, 5E4E, 6OEL, 6WGL, 8K4Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09238	IL4Ra_N	28 → 121	Interleukin-4 receptor alpha chain, N-terminal	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 2 are highly expressed in activated T-cells.
• Sequence:

  MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
  LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
  VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
  EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS
  CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP
  HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
  CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG
  GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
  NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT
  TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE
  AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
  PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
  CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL
  APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS

• Sequence length: 825

Pathways

KEGG:

Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Pathways in cancer
Inflammatory bowel disease

Reactome:

Interleukin-4 and Interleukin-13 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECZEMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IgE responsiveness, atopic	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL4R-related disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, INTERSTITIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECLASSIFIED - MYOC POLYMORPHISM	Benign; Uncertain significance; not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	22570059		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11133768		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21309855, 22087298, 24337880		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	18849614, 29459738		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30193587	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	26645899		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	21857939	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	20444266	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12445201	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15497451, 16646030, 20444266, 21294892, 23983153, 30890897	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	18576348		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10051727, 10390422, 10677312, 10887316, 11398072, 11543630, 11686867, 11709756, 11964717, 12133990, 12911786, 14551599, 14712310, 14984008, 15298559, 15464449, 15479272, 16387595, 16757160, 17083349, 17170387, 17201240, 17284225, 17392323, 17536219, 17586032, 17823973, 17883727, 18849614, 19770271, 19796199, 20002627, 20128416, 20395963, 20484924, 20517665, 20868478, 21749458, 22355322, 22533235, 22541248, 23573270, 23922687, 23924473, 24039878, 25402004, 25994869, 26426602, 27561723, 28326636, 28478972, 29890236, 30488542, 30574168, 30950681, 31123339, 31745261, 31782803, 31805312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	10677312, 11258628, 11709756, 12133990, 16024651, 16757160, 17170387, 17303794, 17392323, 20128416, 21103062, 21324477, 22533235, 22541248, 23527710, 23573270, 24039878, 24838642, 25402004, 26831416, 27561723, 27819719, 31805312, 33774455, 34103634, 34484176, 34662484, 35312711	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	11709756, 12047364, 12940513, 14984008, 17170387, 17586032, 17823973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	27130862, 30929738, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	BEFREE	23706710		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10946814, 27495027	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27495027		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	26693492		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22119518		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30379806		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21323696		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	21323696	Associate	★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	12200373		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25208941		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	20417488	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	25565391	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15329913	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23996684, 27456946		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23529385, 23996684, 28400477, 8287600, 8932345	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	11709756, 29890236		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	24949794		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	24949794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	2736228	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	15138930	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28665449	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25208941		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29408308		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19548368, 22317767, 30472377, 8287600, 8423237	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16902988		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	21729106		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20012175		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25110223		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29756681		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	14615367, 17600229		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17688234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	17688234		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19862939, 20395963, 23573270		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	22317767, 30472377		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	12442007		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22817530		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28739140		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12454749		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17252022, 24245956		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	15842262, 21733492		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29802623, 31830587		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	9560101		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28094779, 30353167		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25526479	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	22317767, 30472377		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28396317		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	20176658		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	8423237	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17258448, 23784081, 30227113		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	1419612, 8530527	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28528324		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12171893, 19548368		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22317767, 30472377		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31269967	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	37565285	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11294568, 11964717, 14571275		★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	14615367	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30177416	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14745651		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29596844	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24742632		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	12406333, 1401997, 21918367, 22533231, 28756630, 29803800, 31596431, 33975024, 39521279	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	29309794	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	29521059	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11678851, 11922633, 12406333, 14527737, 21918367, 24742632, 26426602, 27018548, 28478972, 29122151, 29238761, 29248519, 29312544, 29472119, 30407206, 30488542, 30825336, 31123339, 31252032, 31286499, 31509236, 31595499, 31596502, 31603635, 31707051, 31737955, 31838750		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	11922633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	LHGDN	12748907		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30472377	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	12748907, 19956098, 35404688	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35626661	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39202464	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12401728, 12748907, 14551599, 14712310, 15660293, 16538488, 19956098, 28646042		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22633285		★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	29621254		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19515749, 26448050		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11922633, 12406333, 14527737, 20002627, 21918367, 24742632, 26426602, 27018548, 28478972, 29122151, 29238761, 29248519, 29312544, 29472119, 30407206, 30488542, 30825336, 31123339, 31252032, 31286499, 31509236, 31595499, 31596502, 31603635, 31707051, 31737955, 31838750		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	Pubtator	23480403, 31596431, 34662484	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	BEFREE	31782803		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	37933466	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	37933466	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33895482	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	17006724		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	LHGDN	17006724		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11291041, 17398005, 17804706, 18927306, 31290966		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16024651, 23663500	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16024651, 18927306, 23663500	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18927306		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10427128, 11291041, 16024651, 17398005, 17804706, 18665158, 18927306, 29168083, 29203859, 31290966		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12952292, 17328684, 17805458, 21196282, 22369735, 23395224, 23525950, 23979976, 24030977, 24787244, 27495027, 28938600, 30537472		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15329913, 18927306, 21196282, 23525950, 25170298, 27495027, 36640127	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	14688376	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	15497451		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	17362266	Associate	★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	15161635		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11507072, 12435859, 15853729		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	21729106		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28528324		★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	LHGDN	16226465		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	26693492	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35999655	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11133768, 11318902, 23462527		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11133768, 22902050, 23299779, 37910143, 38081297	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	22902050	Inhibit	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23462527		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	25110223		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	25110223		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	20417488	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	17362266	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26437765, 30472377	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25110223		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15113854, 15161635, 17056243	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16573560, 17056243, 25514189		★☆☆☆☆ Found in Text Mining only
IgE RESPONSIVENESS, ATOPIC	Ige Responsiveness, Atopic	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune system disease	Pubtator	22107611	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	28511637		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11507072, 25208941		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10663555, 11378820, 11528525		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	25526479	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	12442007		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29756681		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	26951255		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22817530	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22817530	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22817530		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	3262383	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	18005266	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	19567201		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	10334974		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	1679753		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28665449		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	16646030	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	15113854	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15497451, 8881918	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36165181	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11964717, 17988330, 8881918		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17988330		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	11756183, 22102710, 26448050, 35851155	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	11756183, 22102710, 26448050		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10728667, 17328684, 18927306, 20805641		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11507072, 12435859, 15853729		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23996684, 27456946		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28142034		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29408308		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16902988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18031948, 19887609, 20068108, 28350325		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19010904		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18628242, 21780194		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25208941		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11507072, 15853729, 16902988, 19065664, 19887609, 22570059, 23464436, 23563734, 26645899, 27456946, 28142034, 31031864		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17688234		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24339977, 28878029		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	27407063		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	11468192		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	11468192	Associate	★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	29467182		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	11870521, 12950150, 15830341	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26993600, 29329051		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	8287600	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	Pubtator	15830341	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	8287600	Associate	★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	23049769		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30639993		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	31269967	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11164908, 14712310, 16625214, 17420820, 27000232, 31264107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16625214		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	16625214, 17420820	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	BEFREE	22119518, 30042722		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	31838750		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	LHGDN	14523823		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	14523823		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10728667, 11748276, 17328684, 20068108, 20176658, 23563734, 25208941, 26645899, 27456946, 27819142, 28350325, 28732245, 28878029, 29329051, 30759882, 8623919		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	11980568		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	8287600	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	26688514		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26437765	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20219689	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	14745651		★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	LHGDN	14745651		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	28420501	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16902988		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39702497, 8287600	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18031948, 19887609, 20068108, 28350325		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20068108		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18031948		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31548328, 35409019	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	22317767, 30472377		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	30890897	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28392616		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	31978095	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12657719, 19010904		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36830725, 37108754	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	31596431	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12445201, 14527737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	12445201	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19279357	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28775096		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	29985726		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12171893, 19548368		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22317767, 30472377		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28739140		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16646030, 17143971, 20444266, 21294892, 21497535, 23972290, 23983153, 24782180		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17143971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	BEFREE	20484924, 27561723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	24075353, 33868246	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	21071541, 21918367	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	12047365, 19117745		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	19117745	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33419470, 8287600, 8423237	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22317767, 30472377		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	18813073		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	33809015	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	9933465	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34349764	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	21760883		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12060640, 23563734		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	LHGDN	17900677		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11309652, 18628242, 21780194, 30526523		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18628242, 22891178, 30526523, 37117331	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	14615367	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	18813073		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11378820, 25526479, 30460209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	8595155	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	32277624	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21071541, 32277624	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	17252022		★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	BEFREE	22240535		★☆☆☆☆ Found in Text Mining only