Gene Gene information from NCBI Gene database.
Entrez ID 3561
Gene name Interleukin 2 receptor subunit gamma
Gene symbol IL2RG
Synonyms (NCBI Gene)
CD132CIDXIL-2RGIMD4P64SCIDXSCIDX1
Chromosome X
Chromosome location Xq13.1
Summary The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined
SNPs SNP information provided by dbSNP.
49
SNP ID Visualize variation Clinical significance Consequence
rs111033618 G>A Pathogenic Coding sequence variant, missense variant
rs111033619 A>T Pathogenic Coding sequence variant, stop gained
rs111033620 C>T Pathogenic Coding sequence variant, missense variant
rs111033621 A>T Pathogenic Coding sequence variant, missense variant
rs111033622 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
4
miRTarBase ID miRNA Experiments Reference
MIRT2015430 hsa-miR-4494 CLIP-seq
MIRT2015431 hsa-miR-4499 CLIP-seq
MIRT2015430 hsa-miR-4494 CLIP-seq
MIRT2015431 hsa-miR-4499 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
RXRA Activation 12149223
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
55
GO ID Ontology Definition Evidence Reference
GO:0002335 Process Mature B cell differentiation IEA
GO:0002361 Process CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation IEA
GO:0002376 Process Immune system process IEA
GO:0002639 Process Positive regulation of immunoglobulin production IBA
GO:0004896 Function Cytokine receptor activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
308380 6010 ENSG00000147168
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P31785
Protein name Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
Protein function Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 (PubMed:15123770).
PDB 2B5I , 2ERJ , 3BPL , 3QAZ , 3QB7 , 4GS7 , 5M5E , 6OEL , 7S2R , 8ENT , 8EPA , 9JQT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09240 IL6Ra-bind 59 151 Interleukin-6 receptor alpha chain, binding Domain
Sequence
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNL
VIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET
Sequence length 369
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Endocytosis
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Measles
Human T-cell leukemia virus 1 infection
Pathways in cancer
Inflammatory bowel disease
Primary immunodeficiency
  Interleukin-7 signaling
RAF/MAP kinase cascade
Interleukin-4 and Interleukin-13 signaling
Interleukin-15 signaling
Interleukin-9 signaling
Interleukin-2 signaling
Interleukin-21 signaling
Interleukin receptor SHC signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
17
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Combined immunodeficiency, X-linked Pathogenic; Likely pathogenic rs2092262300, rs2147751859, rs869320659, rs869320658, rs137852510, rs111033618, rs763359860, rs1057520644, rs1064793347, rs2092261313 RCV001329693
RCV002208750
RCV000763631
RCV000853368
RCV000010706
View all (5 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Nonpapillary renal cell carcinoma Pathogenic rs2147747293, rs111033617, rs1057520644 RCV005912619
RCV005887417
RCV005896247
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SCID with features of gamma chain deficiency Pathogenic rs869320658 RCV006270230
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thyroid cancer, nonmedullary, 1 Pathogenic rs1556329822 RCV005896752
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC SCHIZOPHRENIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DISEASE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute monocytic leukemia Monocytic Leukemia BEFREE 11924909
★☆☆☆☆
Found in Text Mining only
Adenosine deaminase deficiency Adenosine Deaminase Deficiency BEFREE 31589898, 31826240
★☆☆☆☆
Found in Text Mining only
Adrenoleukodystrophy Adrenoleukodystrophy Pubtator 32072341 Associate
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 12225394
★☆☆☆☆
Found in Text Mining only
Agammaglobulinemia Agammaglobulinemia Pubtator 33959125 Associate
★☆☆☆☆
Found in Text Mining only
Agammaglobulinemia Agammaglobulinemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 9743540
★☆☆☆☆
Found in Text Mining only
Alopecia Alopecia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anemia Anemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Ankylosing spondylitis Ankylosing Spondylitis BEFREE 24397353
★☆☆☆☆
Found in Text Mining only