IL2 (interleukin 2)

Gene

• Entrez ID: 3558
• Gene name: Interleukin 2
• Gene symbol: IL2
• Synonyms (NCBI Gene): IL-2, TCGF, lymphokine
• Chromosome: 4
• Chromosome location: 4q27
• Summary: This gene is a member of the interleukin 2 (IL2) cytokine subfamily which includes IL4, IL7, IL9, IL15, IL21, erythropoietin, and thrombopoietin. The protein encoded by this gene is a secreted cytokine produced by activated CD4+ and CD8+ T lymphocytes, th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025034	hsa-miR-181c-5p	Reporter assay;qRT-PCR;Other	21112091
MIRT041627	hsa-miR-484	CLASH	23622248
MIRT054292	hsa-miR-155-5p	qRT-PCR	22785227

Transcription factors

Transcription factor	Regulation	Reference
BACH2	Unknown	18769450
CREB1	Unknown	8814256
CREM	Repression	15841182
CREM	Unknown	12370343
EGR1	Unknown	12560487
ETS1	Repression	7876544
FOXK2	Unknown	16624804
FOXP3	Repression	18324310
HDAC1	Repression	17056544
ILF2	Unknown	9065434
ILF3	Activation	18097023
JUN	Repression	7642615
JUN	Unknown	8468462
KAT5	Unknown	11145913
KLF2	Unknown	16116194
NFATC1	Unknown	12560487
NFKB1	Activation	11035116;18207244;19968887;7623820;7957556;9233628
NFKB1	Unknown	11145913;12027419;15477007;8814256;8834450;8977179;9135552;9737979
POU2F1	Activation	11781715
POU2F1	Unknown	9135552
REL	Unknown	8920856
RELA	Activation	11035116;18207244;19968887;7623820;9233628
RELA	Unknown	11145913;12027419;15477007;8814256;8977179;9135552;9737979
RUNX1	Activation	17466384
SATB1	Unknown	15713622
SP1	Unknown	8814256
STAT3	Activation	18550668
TOB1	Repression	11694881
VDR	Repression	7565732
ZFP36	Repression	15634918

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002366	Process	Leukocyte activation involved in immune response	IDA	16204630
GO:0002376	Process	Immune system process	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IGI	22962438
GO:0002903	Process	Negative regulation of B cell apoptotic process	IDA	9184696
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	1830926, 10072077, 21516110
GO:0005125	Function	Cytokine activity	IEA
GO:0005134	Function	Interleukin-2 receptor binding	IBA
GO:0005134	Function	Interleukin-2 receptor binding	IDA	8262055
GO:0005134	Function	Interleukin-2 receptor binding	IEA
GO:0005134	Function	Interleukin-2 receptor binding	TAS	3925347
GO:0005515	Function	Protein binding	IPI	16477002, 17032757, 22446627
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18273057
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	6608729
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	2342538
GO:0007155	Process	Cell adhesion	TAS	10929056
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8476561
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8476561
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8476561
GO:0010467	Process	Gene expression	IEA
GO:0019209	Function	Kinase activator activity	TAS	8476561
GO:0030101	Process	Natural killer cell activation	TAS	8476561
GO:0030217	Process	T cell differentiation	TAS	8476561
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030307	Process	Positive regulation of cell growth	TAS	8476561
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	9184696
GO:0031851	Function	Kappa-type opioid receptor binding	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IBA
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7568005, 7973659, 8631883, 16293754
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	22844114
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	1830926, 10072077
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	8476561
GO:0043208	Function	Glycosphingolipid binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046013	Process	Regulation of T cell homeostatic proliferation	IEA
GO:0046651	Process	Lymphocyte proliferation	IEA
GO:0048304	Process	Positive regulation of isotype switching to IgG isotypes	IEA
GO:0050672	Process	Negative regulation of lymphocyte proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	19088061
GO:1900100	Process	Positive regulation of plasma cell differentiation	IGI	22962438
GO:1901327	Process	Response to tacrolimus	IEA
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IEA
GO:2000561	Process	Regulation of CD4-positive, alpha-beta T cell proliferation	IEA

Other IDs

• MIM: 147680
• HGNC: 6001
• e!Ensembl: ENSG00000109471

Protein

• UniProt ID: P60568
• Protein name: Interleukin-2 (IL-2) (T-cell growth factor) (TCGF) (Aldesleukin)
• Protein function: Cytokine produced by activated CD4-positive helper T-cells and to a lesser extend activated CD8-positive T-cells and natural killer (NK) cells that plays pivotal roles in the immune response and tolerance (PubMed:6438535). Binds to a receptor co
• PDB: 1IRL, 1M47, 1M48, 1M49, 1M4A, 1M4B, 1M4C, 1NBP, 1PW6, 1PY2, 1QVN, 1Z92, 2B5I, 2ERJ, 3INK, 3QAZ, 3QB1, 4NEJ, 4NEM, 5LQB, 5M5E, 5UTZ, 6LX3, 6LXW, 6VWU, 6YE3, 7DR4, 7M2G, 7RA9, 7RAA, 7YZJ, 7ZMZ, 8SOW, 8SOZ, 8WYR, 8WYS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00715	IL2	7 → 150	Interleukin 2	Domain

• Sequence:

  MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
  TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
  TTFMCEYADETATIVEFLNRWITFCQSIISTLT

• Sequence length: 153

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
PI3K-Akt signaling pathway
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Yersinia infection
Chagas disease
Measles
Human T-cell leukemia virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Autoimmune thyroid disease
Inflammatory bowel disease
Allograft rejection
Graft-versus-host disease

Reactome:

RAF/MAP kinase cascade
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
Interleukin-2 signaling
Interleukin receptor SHC signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Breast neoplasm	Pathogenic	rs2484754163, rs2484759187	RCV002285229 RCV002285230	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ARCH SYNDROMES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHENIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATAXIA TELANGIECTASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BULLOUS PEMPHIGOID	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTEATOMA OF MIDDLE EAR AND MASTOID	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL2-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, INTERSTITIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIDDLE EAR CHOLESTEATOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHIC OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOID SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEMPHIGUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, LIMITED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VAGINAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	2110212, 8349943		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30224390		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1434844, 3135977		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11924909, 1351762, 17205058, 2243505, 26984209, 30212785, 6982237, 8391615, 8429680		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	8425202		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11924909, 15585413, 19283381, 8445947		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	17275030, 8168121		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	7641214, 8989990		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	12521324		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	1331177		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17205058, 30212785		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25429725, 30188236, 30790452, 30947577, 31383650		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	31827396		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15688386, 16982932, 18077789, 23028547, 30778533		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	2395860, 8530186		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10378889, 11228744, 11503967, 11992406, 12057109, 12225394, 12406087, 1288288, 14630083, 1675581, 17950728, 18511807, 1861543, 2121691, 2172979, 22010857, 22068231, 22402124, 2300570, 2367534, 2383656, 2495724, 25175936, 26396258, 27247421, 2846094, 28646117, 2866223, 2874115, 2874849, 2883237, 2887587, 2888269, 2889484, 2889666, 28910419, 2891729, 2893506, 2985731, 2988127, 2990687, 2996399, 2999237, 3001715, 3024966, 30353031, 3119325, 6330695, 6603529, 6608103, 6982237, 7564472, 7803265, 7812510, 8049647, 8092127, 8095337, 8099324, 8176252, 8390425, 8400227, 8628012, 8878449, 9177442, 9356333, 9973953		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	23962110		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	12147628, 30367666, 30449228, 31669890		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25543336		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	12521324		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	11350504		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	2487682, 29941704		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10716257, 25197660, 31123295, 31611872	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	15660915, 29697859		★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta, Type IB	Amelogenesis Imperfecta	BEFREE	29233784		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	CTD_human_DG	8241462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	27829339		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30219498		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	26599070	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	28960399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	CTD_human_DG	7678812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Aplastic	Aplastic anemia	Pubtator	26764034, 30907293	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	27281795, 28268223, 28459238, 2981588, 36334505	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Iron Deficiency	Iron deficiency anemia	Pubtator	20724768	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10641497, 33776989	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11014893		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	28260995	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17949552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26130142, 27901054, 30985663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22576056		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	CTD_human_DG	8635092		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior uveitis	Uveitis	BEFREE	9856775		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28079600		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28079600		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	30139310		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30139310		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	12521324		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	30139310		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	31290753		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	33776989	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22062588		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	1747947, 28093521, 28273637, 28631356, 28972439, 29972778, 3263464		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	19565513, 22035391	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	8544415	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	1747947, 20072139, 20722033, 23603761, 2975541	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	1747947, 3089651	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10403280, 10728756, 11156551, 12165096, 1747947, 17999365, 18369459, 19201773, 19302705, 2016122, 20553587, 20850384, 21765104, 21875375, 22355377, 23121884, 2330842, 25430993, 26149185, 26350950, 2827831, 29379122, 2964958, 30327652, 30718650, 3089651, 3091636, 31167762, 3127092, 33362761, 37934808, 8380369, 9665944, 9771211	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1914237	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	2972426, 6190598	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	1747947, 22328738		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10228104, 1374772, 1530827, 18972297, 20599261, 23414538, 25747600, 27440276, 29053714, 29678672, 30260198, 7742012, 9560836		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11413353, 18780949, 19217272, 20926789, 27848966	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	1530827, 38253462	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	18780949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	2172158, 6604606	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	22062588		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10889591		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10889591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29602155, 31125917		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	16360218, 18929414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	18220288, 28700730, 29288086, 29323192		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10209065, 10798759, 11318598, 11525806, 12149223, 12220550, 12359737, 15110223, 1627788, 16621991, 17130555, 17371467, 17514769, 17999365, 18369459, 18650128, 18723131, 19125193, 19155502, 19269352, 19343617, 19447046, 19701192, 1973822, 19875613, 20112382, 20184734, 21282039, 21304239, 21317396, 21722762, 21875375, 21976679, 22129253, 22211793, 22288682, 22809281, 22933152, 23172754, 23190644, 23416241, 23645042, 23676143, 24154763, 24376757, 2527100, 25416807, 25445496, 25736261, 25992858, 2659803, 28556984, 28646040, 28708863, 28850267, 29055191, 29210727, 29234980, 29259102, 29323192, 29414661, 29527328, 29980618, 30089912, 30104245, 30224390, 30282751, 30374354, 30415086, 30446251, 30472651, 30729267, 30880061, 30894405, 30985663, 31005777, 31040184, 31056472, 31110501, 31221786, 31262730, 31337738, 31411745, 31570576, 31622625, 31781109, 8298124, 8583224		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15569157, 17999365, 18369459, 20072139, 20179739, 20184734, 21179116, 21425124, 21765104, 21976679, 22129253, 22461703, 23172754, 23676143, 24154763, 24376757, 24462799, 25629163, 25634360, 29379122, 34324441	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12443879, 15300803, 17438098, 1765644, 18227840, 21811057, 26396258, 29696509, 29904934, 30936059, 31383650, 9731068		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	25301672, 30068596, 7994039, 8090033, 9858820		★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome	Bare Lymphocyte Syndrome	BEFREE	8244777		★☆☆☆☆ Found in Text Mining only
Bare lymphocyte syndrome 2	Bare Lymphocyte Syndrome	BEFREE	8244777		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	18192685		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10513814, 10759778, 25303043	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	11600199, 17211678, 21640045, 21816027, 23331481, 25410656, 26654556, 27467286, 28468317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	12579325		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	6319491		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11019784, 12920242, 27173438, 29441606		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	11845258		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	15128911	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	16609995		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10070868, 19832038, 22242968, 28113097, 28205361, 28599483, 29517678, 31499716, 8459207		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	1949363, 3495671		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	11924909, 2996659		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	23607634	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	27670221	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	10491011, 2367534		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12181060	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly type C	Brachydactyly	BEFREE	11845258		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11023199, 11961669, 22996231, 2365829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	15471828, 2365829	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	20719934	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	6319491		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	6319491		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	9498799		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10435085, 11001550, 11106253, 11213967, 11948133, 11961669, 12494899, 12649188, 12865933, 12893496, 15548763, 1601521, 17546596, 18538434, 18927291, 19051009, 19446661, 20529245, 23477313, 2460238, 24670917, 26403072, 27151235, 28274688, 28713391, 29511983, 2962732, 30842160, 31493284, 3265486, 7667323, 8617977, 9259972, 9551618, 9724088, 9878115		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14680494, 17261184, 18632641, 19051009, 20418110, 20529245, 24670917, 2998661, 30579865, 30814616, 33667790, 37388747, 7923245, 9878115	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29867227	Inhibit	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	10910440, 9403216		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	10228104		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	7544620		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	8711646	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	27814345	Inhibit	★☆☆☆☆ Found in Text Mining only
Brucellosis	Brucellosis	Pubtator	20404074	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	24007426	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	8386135		★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	15654826, 24885155, 35839426	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10555752, 10698521, 10773410, 1706402, 21282337, 30808414, 8439980, 8785705, 9546432		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	8450029	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14726965, 22469170, 29568203, 29706626, 34603293, 36994687	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25169554	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29666149	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	14680494	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10070868, 19832038, 22242968, 28113097, 28205361, 28599483, 29517678, 31499716, 8459207		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11129324, 1314129, 1997188, 24935593, 27998891, 29408308, 29616326, 8978294, 8989990		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21203522, 31388197, 34359872, 9649178	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34408923	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35127251, 39684873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10478643, 10491412, 15250044, 15654826, 18712176, 19364969, 23141780, 23226513, 24885155, 25205170, 25245327, 25424850, 27695964, 8431359, 9024506, 9756417	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10903800, 15517589, 15709712, 17279417, 18082202, 19188179, 1968360, 24768357, 24777966, 25089268, 26307625, 34551906, 36923304, 7967440, 8439981, 8603537	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	14511235, 16309178, 18628433, 9119749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	16283306	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21980389, 26609634, 8450029		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11780319, 15214947, 27035425, 28513532, 31443604, 8623798, 9649178		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	8800994		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	33319833	Stimulate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	10469047		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32855850	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12941768, 16567828, 17558408, 17999365, 18311140, 18369459, 18418394, 19201773, 19455118, 19693089, 21688385, 21875375, 22077623, 26535636, 31483515, 31622625, 31839959, 7638572, 8307450		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	LHGDN	17558408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	17999365, 18369459, 19648293, 21760890, 21875375, 28049849, 35354862	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	21288140	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	25920553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	28592627		★☆☆☆☆ Found in Text Mining only
Central nervous system demyelination	Central Nervous System Demyelination	BEFREE	28542613		★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	2110212		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	31752816		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30291203, 30444079, 31356182		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15337523, 20227890, 21370592, 21693061		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	10073700, 9563486		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15337523, 20227890, 21370592, 21693061		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	17635814	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17205058, 30212785		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	26980726		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	25747600		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	31036433		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	31827396		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	2395860, 8530186		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16609995		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	1847844	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37973660	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	27965154		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	21425313	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	27965154, 29698570		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	10365823		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	27558944	Stimulate	★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	30150979		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	1942774		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29619880		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	16425355		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10087947, 10812246, 11924909, 12149223, 1421405, 1532590, 15946308, 16179374, 16517754, 1717997, 18941194, 19582829, 19710697, 20362231, 21745159, 22623161, 23596118, 24246692, 25301672, 25398834, 25502547, 26984209, 27077766, 27327088, 27565124, 29315094, 29349871, 29899839, 30068596, 3142777, 3261624, 7902734, 7994039, 8056442, 8090033, 8639905, 9858820		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19279357, 26498252, 30278779		★☆☆☆☆ Found in Text Mining only
Chronic osteomyelitis	Osteomyelitis	BEFREE	31555698		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	11023273, 11350504, 12354082, 19453859		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21198766, 24670840	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	24161121, 8076766		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	24777966		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22174866	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	15039318, 19369513, 23853094, 27965154, 29441062, 29503742, 29549257, 29666981, 30930900, 31217192, 9886424		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	34226674	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12974765	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19201773, 21425313, 26900298, 8050181, 8063224, 8100205, 8915691, 9697979	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	8707086	Stimulate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	11845258		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10551331, 10608345, 10851450, 14652292, 17585452, 17589921, 19242529, 30626941, 8827016, 9020917		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23902851	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29632732, 9918202		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10499605, 10981668, 16714222, 19863607, 22699929, 28000528, 29193199, 29691298, 30372868, 31077581, 31519598, 31522446, 7578396, 9042431, 9924696		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10576658, 10691913, 12610520, 14612896, 15188028, 22276195, 27619682, 28210081, 30973070, 31522446, 34830445, 34931923, 35720311, 39456247, 9292704	Associate	★☆☆☆☆ Found in Text Mining only
Combined Saposin Deficiency	Combined saposin deficiency	Pubtator	24373350	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	10361243, 11876763, 2110212, 28718914, 8349943, 9486401		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10361243, 12100033, 20629103, 26684629, 7508119, 7905793, 9246212, 9367399, 9486401	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	22710188		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	23596118, 25301672, 27565124		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30052486		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10388747, 10854152, 11691814, 12815341, 16635513, 17206887, 1790142, 18317356, 19128501, 19539328, 19810129, 20168351, 21258414, 22303460, 22715591, 23677467, 23867518, 24727990, 24895689, 27916626, 28056941, 28222071, 28315535, 28321811, 28341412, 28344662, 28448047, 28545581, 28939740, 29443657, 29460635, 29520448, 29728867, 30342473, 30343514, 30415086, 30710374, 30777131, 30848378, 31160329, 7521786, 7523315, 7584072, 7591233, 8325704, 8341057, 8423625, 8443817, 9610908, 9723777		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	31756391		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	23742784, 28081636		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23715819, 28238270, 30224390		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23715819, 23742784, 28238270		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23715819, 28238270		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	34719421	Inhibit	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	22342787	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	36312898	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31266741, 31326447		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	17444587		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33041191	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	1568572, 15827446, 19471255, 20584322, 23014361, 23929016, 24098138, 30884988, 7543040, 8050181, 8425687, 8436398, 9207269		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	1568572, 7664489	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19201773, 21129005, 24098138, 34120187, 40248067, 8915691	Associate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	Pubtator	22129253	Inhibit	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	22932225		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	14675394, 18593361, 31566658		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	27757545		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25742660		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29207652		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11238664, 18508030, 2016122, 9032818		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	26215633	Stimulate	★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	29529166, 29549829		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	29529166	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	28929835		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	37957648	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	10759780	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11793857, 26934083, 28918107, 30314474, 30405261, 30711869		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	21158938		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	2002256, 2007785, 22427475, 36587063	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33390552	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	11312644, 22245253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	15356430, 15660915, 16333313, 18234309, 22427475, 27554821, 9164367		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Irritant	Dermatitis	BEFREE	8654078		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21158938, 28884915, 28892206		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	12147628, 30367666, 30449228, 31669890		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	37098880	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	11960373, 17021139		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	8977230		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17130555, 17332083, 21317396, 28142150, 29577632, 6607315		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27294162	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36203592	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12153522, 25363329	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16864906, 27560779, 32265833, 34951048	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17130555, 17332083, 21317396, 28142150, 29577632, 6607315		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16864906, 17999365, 18369459, 19201773, 19875613, 20553587, 21829393, 21875375, 22461703, 22891215, 24098138, 24154763, 24773525, 25392936, 25634360, 26224887, 26646829, 27560779, 27727279, 28053319, 28645874, 29491471, 31110501, 31172216, 33572095, 36443294	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19654878, 24376757, 30282826, 31299986, 37700317	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30270447	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34763485	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35801423	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12941768, 14735147, 15776395, 17327427, 17999365, 18299186, 18369459, 18417224, 18481948, 18782261, 19119414, 1914257, 19155502, 19471255, 19523143, 19654878, 19701192, 21875375, 22187370, 22891215, 22932816, 23539116, 24098138, 24154763, 24342660, 24705559, 24773525, 2527100, 26224887, 27560779, 28053319, 28377612, 28417857, 28611472, 28645874, 28850267, 29259102, 29266506, 29414661, 29445381, 29454391, 29491471, 29942088, 30282826, 30415086, 30905013, 31110501, 31172216, 31560963, 3531850, 6239872, 6368290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	16864906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28645874, 30270447, 31496653, 31672458, 3531850		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	18481948, 21317396, 8297521		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35394091	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29682583		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	27525838	Stimulate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	18684212	Inhibit	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	27737881		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25429725, 25860238, 27439595, 30188236, 30790452, 30947577, 31007846, 31383650		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	24406074		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	1824688, 31785499		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	32476816	Stimulate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	21203348	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	18761558		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	31450770		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	22958187		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15356430, 15660915, 18234309, 22427475, 27554821, 9164367		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	28538696	Inhibit	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30554038, 31349155, 31678190		★☆☆☆☆ Found in Text Mining only
Encephalomyelitis Acute Disseminated	Acute disseminated encephalomyelitis	Pubtator	33597947	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	30657459		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35712817	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	31148852		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16084898, 29308924, 32432788	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29308924		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34360900	Inhibit	★☆☆☆☆ Found in Text Mining only
ENDPLATE ACETYLCHOLINESTERASE DEFICIENCY (disorder)	Endplate acetylcholinesterase deficiency	BEFREE	7907636		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	28057433, 33891982	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	23472217	Inhibit	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24732104	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	12672048, 9432015	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30930900, 8386711		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21921589	Stimulate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	30778533		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	30778533	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Epidermolysis Bullosa	BEFREE	26496255		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis Bullosa Simplex	BEFREE	26496255		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	34536484	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29937116		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	24487795		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28513532, 31443604		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	17571248		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	9110151		★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	19062180	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11096347, 9824634		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11096347, 9824634		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	32947843	Stimulate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	12217197, 15170886		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	30203425	Associate	★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	BEFREE	29131274		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	21943235		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	23619121, 2484652		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	23619121		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	20447453, 22973830, 34831634	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	37179299	Stimulate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17222831, 31148852		★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	30054161, 31004723, 31156792		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	2212951, 8785705, 8985520		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	24487795		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	16611376, 28040582		★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	30054161, 31004723, 31156792		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	36890594	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastric Cardia Carcinoma	Gastric Cardia Carcinoma	BEFREE	19058298		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	18761558		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	32947843	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	15904474, 18761558		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	20049409		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19706801	Stimulate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	2785002, 30941959	Stimulate	★☆☆☆☆ Found in Text Mining only
Generalized enlarged lymph nodes	Enlarged Lymph Nodes	BEFREE	2168506		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	10025926	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21269573		★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	7719933		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	20193755		★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	25811482	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25811482, 35052396	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31131239		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10066092, 15891772, 17398005, 19565921, 29328445, 3497030, 7719933, 9711724		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	1848799, 26180083, 32326230, 3322813	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	7719933		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	10066092, 15891772, 17398005, 19565921, 29328445, 30049387, 3497030, 7719933, 9711724		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	7719933		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10077220, 11961669, 23103669, 29328445, 29582851, 30049387, 7648444, 9316052, 9935185		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12864971		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	1827092	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	11023199		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10910440, 9403216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	20506162, 8398664		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	1477028, 2785227, 7908616	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	15200413		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	15200413	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	10999463	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12239181	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	18021367, 20446793	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	7641221	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	12171778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12239181, 12859540, 14688528, 18021367, 24599414, 25445496, 27862977, 28119258, 28447161, 28470889, 29751114, 30383447, 30957314, 7652763, 7787751, 8136279, 8496391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	11529927, 8455368		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	35039330	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	18369459, 20960273, 21815908, 29406821, 8376808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	18369459, 9222097	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	1866024		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	1394125, 3135977, 8329708		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	21623768	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10389944, 10773410, 11735339, 1408194, 15744147, 21845339, 7790320, 8816835, 9171230		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21845339	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17635814	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21935395, 38065888	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35409075	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11106253, 11750110, 19344187, 26984209, 28716814, 29055191, 31624330		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	15539078		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	28871325		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	11924909, 30353031		★☆☆☆☆ Found in Text Mining only
Hemophagocytic lymphohistiocytosis familial 4	Hemophagocytic lymphohistiocytosis	Pubtator	17525286	Associate	★☆☆☆☆ Found in Text Mining only
HEMOPHAGOCYTIC LYMPHOHISTIOCYTOSIS, FAMILIAL, 2	Hemophagocytic Lymphohistiocytosis	BEFREE	16365863		★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	12707056, 28497365		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	21362111	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	24684505, 29993342		★☆☆☆☆ Found in Text Mining only
Hennekam lymphangiectasia lymphedema syndrome	Hennekam syndrome	Pubtator	3159524	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	21940902	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	35806450	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19625194, 29682590, 30602374, 32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22241125	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26823800	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29643189, 32664850, 8706330	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29666149, 35801423	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	20483710	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32532356, 35806450	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	22139496		★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	26684629	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10903800, 7923245	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	28668113, 29843647, 31407508		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12100149, 16982932, 21385932, 30778533, 8704179	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	14685154, 15688386, 1691591, 16982932, 2280610, 23028547, 2305833, 30778533, 3261271, 8506943, 9407718		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18077789		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24007426	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22130161	Inhibit	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	27695964, 27742794, 36923304	Associate	★☆☆☆☆ Found in Text Mining only
Hyalinosis, Systemic	Hyalinosis	BEFREE	30684712		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	8857018		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	2887587, 8099324, 8380405		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	8380405, 8514609	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27121486, 29997625		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	27121486	Associate	★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	31049005		★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	2037012, 7864028		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	1726707		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	8207793	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20145925		★☆☆☆☆ Found in Text Mining only
Hyperimmunoglobulin M syndrome	Hyperimmunoglobulin M Syndrome	BEFREE	2445512		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	9596698	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30892934		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	29131274		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	29131274	Associate	★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	31267524		★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	16304363, 21303357		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	35839426, 9756416	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	28534148		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	39185088	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18227840, 23724099, 34999917	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21535870	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	27554821	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	1726707		★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	18772143		★☆☆☆☆ Found in Text Mining only
Idiopathic Hypogonadotropic Hypogonadism	Hypogonadotropic hypogonadism	Pubtator	18772143	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28648519		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	14680494	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16573560		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	7908616		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	2139699, 31040185	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29527328, 30885291, 31040185, 31494958, 31781109, 6607315, 9486390		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	15630504, 20626741, 22111667, 27862977, 29144585, 29971001, 29979258, 30055825, 30808044		★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 13	Immunodeficiency	BEFREE	25463685		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	16386644		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16306607, 16939817, 18234797, 18275276, 20012395, 20150806, 23059428, 24607601, 25712215, 27959627, 28089909, 28470889, 30480508, 3121226, 7803808, 7937790, 8857018, 9502779		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18772143	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12039914, 15039318, 19201773, 19471255, 23853094, 28685527, 28961693, 29057517, 29549257, 30134230, 30373817, 30760618, 30930900, 7543040, 8436398, 8642289, 9697979		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19201773, 20629103, 34226674	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	21158938		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	33004937	Associate	★☆☆☆☆ Found in Text Mining only
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	BEFREE	17586580		★☆☆☆☆ Found in Text Mining only
Interleukin 2 Receptor, Alpha, Deficiency of	Interleukin 2 Receptor Deficiency	BEFREE	23416241		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32620160	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	10844519		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	1568572	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30366277		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	12635532		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	12635532		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	18684212	Inhibit	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31172560		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	34115808	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30291203		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	35673992	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	1747947, 20072139, 25057181, 27040810, 2961576		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36051483	Associate	★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	27737881		★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	8450029	Stimulate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	1675581, 27793034		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30407752, 31535918		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	1942774		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27898347, 31191312		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	1942774, 20528849		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	17105418, 18298334, 18625569, 19409039		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	18317356		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	2036660, 2289209	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	8567975, 9742914	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	22699929		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21845339	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	8800994		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	19058987, 21807564, 22527432		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	22527432, 23563829, 35462022	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	22527432	Associate	★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	6608383		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10378889, 11189449, 12424204, 15793300, 17993614, 1831682, 18759005, 20858854, 2121691, 2189508, 22689678, 23451206, 2383656, 24489097, 2538542, 2546621, 26288134, 2784064, 2804349, 2833327, 2866223, 2889484, 2898464, 3094603, 3098894, 3110786, 3262015, 3262382, 3263150, 3484512, 3489494, 3928803, 6327770, 7519476, 8390425, 8605349, 8639910	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	11924909, 12443879, 12473581, 12494899, 1698543, 1861543, 19344187, 20580754, 20664358, 2172158, 22627572, 23451206, 25109334, 25736261, 26984209, 2786034, 2822168, 28721449, 2999237, 3019203, 30212785, 31570576, 7533866, 7812510, 8535054, 8892624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	LHGDN	15152368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	CTD_human_DG	17500047		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	19567201, 2504308, 27341131, 28721449, 2992637	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	8096405	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	6975673	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15585413, 16940427, 22689678, 25757160, 26081440, 27341131, 2790193, 3257887, 34312685, 34956230, 37648262, 39867885, 7693036	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24757092, 28529313, 28721449, 31242079	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	14687623, 1831681, 1835747, 2146981, 3110786, 8978293, 9403005		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10193940, 12231521, 15585413, 16940427, 1699903, 18756547, 19283381, 19724059, 22855599, 23619121, 24297940, 25109334, 26655503, 28235771, 28529313, 28721449, 29967760, 29980537, 30647027, 31242079, 7637393, 7718644, 7869744, 8445947, 8630406, 9130610, 9485189		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10378889, 11228744, 12149223, 12225394, 1288288, 1379847, 14630083, 17950728, 1861543, 2111591, 2121691, 2172979, 22068231, 22402124, 2300570, 2367534, 2383656, 26396258, 27247421, 2846094, 2866223, 2874849, 2883237, 2887587, 2888269, 2889484, 2889666, 2891729, 2893506, 2985731, 2988127, 2990687, 2996399, 2999237, 3001715, 3010456, 3019203, 3024966, 30353031, 3263150, 6330695, 6603529, 6982237, 7564472, 8049647, 8092127, 8095337, 8099324, 8390425, 8400227, 9177442, 9356333, 9973953		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	LHGDN	11940709		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	30671026		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	CTD_human_DG	7678812		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10089963, 12489031, 29664031		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10190313, 10341290, 10861483, 10933975, 10965816, 16425355, 20686664, 25169554, 25173083, 26303327, 27174862, 27736965, 29115604, 29552184, 29568203, 29958796, 30062618, 30127666, 30459526, 30854665, 31710117, 31827396, 8940638, 9449371, 9864400		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24161121, 25173083, 8076766		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	3262458	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	36159788, 8565296	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	18794598		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19860911, 25953611, 28176332	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36159788	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28197212		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10933975, 15259063, 26303327, 27174862, 27736965, 9864400		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	18298334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Neoplasms	Liver neoplasm	Pubtator	1847844	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Localized scleroderma	Scleroderma	BEFREE	30618531, 31157654		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24024324, 29065892	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28321811, 31085455		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	20089076, 21257923, 30449228		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	11129324, 20565977, 24024324, 32788875, 33277856, 33480074, 7591964, 8978294	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15048152, 40222041	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	18298334, 18625569, 7614408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	7842293, 8989990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11390516, 20001649, 20506162, 21425124, 22406048, 22736314, 22942433, 23019580, 28646040, 30407752, 30715676, 31103267		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11238674, 11315925, 1888202, 21976679, 24368769, 27183584, 31653682, 34130625, 6190598	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12370343, 12847689, 1477028, 15322221, 16224536, 17237447, 19201773, 19399944, 21346232, 21425124, 21437440, 21590681, 21746932, 22028659, 22479496, 22736314, 23019580, 23280105, 23319613, 2530012, 27904655, 2952381, 2974765, 31871930, 33763079, 34240405, 34895341, 36536372, 39333474, 8603537	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33882880, 36506019, 39818255	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11115160, 11390516, 20001649, 20506162, 21425124, 22406048, 22736314, 22942433, 23019580, 28646040, 30407752, 30715676, 31103267		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10209065, 11238674, 11390516, 12027419, 12064833, 12370343, 12746905, 12847689, 15204092, 15322221, 15841182, 16224536, 16431340, 17211988, 17237447, 1888202, 19269352, 19399944, 20001649, 20506162, 21231893, 21346232, 21425124, 21590681, 21746932, 21953500, 21976679, 22281835, 22406048, 22736314, 22933064, 22942433, 23019580, 23124208, 2323107, 23319613, 2353574, 23645042, 24368769, 26432764, 27183584, 27255473, 27482100, 27510529, 27798123, 2784626, 27904655, 27992687, 28438897, 28646040, 28736280, 29414661, 29670626, 29700819, 29704668, 29941704, 30143591, 30407752, 30415086, 30562181, 30715676, 30721117, 30892934, 31103267, 31450016, 31484501, 31537547, 3155152, 31614462, 31653682, 31740549, 7841998, 8603537, 8881918, 9276525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15841182, 18650128		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	27914701, 30721117, 31103267, 31614462		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	31685786	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11390516, 20001649, 20506162, 21425124, 22406048, 22736314, 22942433, 23019580, 28646040, 30407752, 30715676, 31103267		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	30834995		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	1997188, 7910532, 8977230, 9525643, 9742914		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	12351400	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	12707056, 24509696, 26947179, 28093696, 29296904, 29843647, 30075527, 30292629, 30723637, 30944043		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10576658, 19509224, 2036661, 22524835, 2305833, 24007426, 2789474, 3120822, 34334531, 3489494, 37329186, 8698322, 9763110	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1498262, 15517867, 17900685, 18025151, 19344187, 19421230, 19509224, 19719389, 22524835, 23028547, 2305833, 24007426, 24094496, 24856896, 25550870, 2659803, 28871325, 29189373, 3010456, 30514094, 31013298, 31126350, 6322876, 9546789		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17327408	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12060117, 27267694, 28413914		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12060117, 12153001, 29218366, 29696509		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10087947, 10950372, 11477458, 11924909, 12060117, 12153001, 1568183, 20193734, 22472080, 29218366, 29696509		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16690518		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10087947, 10950372, 11477458, 12060117, 12153001, 1568183, 20193734, 22472080, 29218366, 29696509		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	12443879, 12543077, 18025151, 18245523, 18281483, 19344187, 20212249		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	8941669		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	10197373, 22544392, 29234980		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	LHGDN	17142786		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	12766168	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	2402757, 25429725, 3135977, 8329708, 9021695		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	8605349	Associate	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	30061130, 30671214		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25543336, 31608440	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	12635532		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	2135065, 30314474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10389944, 11735339, 1408194, 15744147, 21845339, 7790320, 8816835, 9171230		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	29301121		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	9610913		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	22996231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	6319491		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10435085, 11001550, 11106253, 11213967, 11948133, 12494899, 12649188, 12865933, 12893496, 15548763, 17546596, 18927291, 19051009, 19446661, 23477313, 24670917, 26403072, 27151235, 28274688, 28713391, 29511983, 30842160, 31493284, 7667323, 9259972, 9551618, 9724088, 9878115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11096347, 9824634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1423266, 15897568, 16304057, 17571248, 1968360, 21387109, 21577143, 24907378, 25736261, 28000528, 29453736, 7521786, 9742914		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	17105418, 18298334, 18625569, 19409039		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	21845339		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15259063, 27240457, 30459526, 30476722, 31827396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	18298334		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11129324, 1997188, 24935593, 27998891, 29408308, 29616326, 8978294, 8989990		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	18298334, 18625569, 7614408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10089963, 12489031, 29664031		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	21845339		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11780319, 15214947, 27035425, 8623798		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10404069, 26849077, 31114758, 9080118, 9185703		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11019784, 11387054, 15076142, 17115417, 20184734, 29441606, 30761160		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17115417		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18761558, 28111424, 28458166, 28901504, 30071135		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	18289047		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12534360		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10070868, 19832038, 22242968, 28113097, 28205361, 28599483, 29517678, 31499716, 8459207		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	1949363, 3495671		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10368673, 10566144, 10851445, 10854152, 11023201, 11062441, 11902815, 11924909, 12149223, 12231521, 12473581, 12609842, 12839930, 12925674, 15361708, 15373345, 15515141, 16516672, 16621991, 17115417, 17935281, 18538434, 1912580, 20225066, 20227890, 21687929, 21722762, 2191681, 21994418, 22446627, 22706381, 23028547, 2347603, 23477313, 23677467, 2460238, 24613899, 24645750, 24907378, 2495037, 24971746, 25736261, 25992858, 26094531, 26170385, 26386966, 2659803, 27151235, 27240457, 27782752, 27803062, 27824739, 27916626, 28000528, 28197364, 28198830, 28205361, 28321811, 28321817, 28405498, 2846094, 28708863, 28716814, 28741710, 28754817, 28860806, 28916655, 28939740, 29115604, 29163482, 29328445, 29349871, 29443657, 29460635, 29483127, 29496879, 29517678, 29520448, 2962732, 29636345, 29662489, 29691298, 29854806, 29907868, 29959196, 2996399, 29971465, 29980186, 29980618, 29982719, 30012672, 30089912, 30104245, 30318089, 30353031, 30413827, 30415086, 30514094, 30693030, 30718426, 30782667, 30971453, 31040185, 31180133, 31262730, 31348125, 31462678, 31662754, 31790729, 6604273, 7499443, 7515167, 7584072, 7757988, 8101762, 8298124, 8400227, 8439980, 8609413, 8785705, 9033626, 9192768, 9356333, 9373351, 9502779, 9652792, 9813672, 9815891		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	12579325		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	11023201, 12124336		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15337523, 20227890, 21370592, 21693061		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10551331, 10851450, 14652292, 17585452, 17589921, 30626941		★☆☆☆☆ Found in Text Mining only
Malignant Vaginal Neoplasm	Malignant Vaginal Neoplasm	CTD_human_DG	15577323		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	12220550		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	23429441	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10996629, 11775545, 26141233, 28274688, 28466296, 31189644, 9192989, 9588898		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29301121		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	11733228, 8954146, 9449631		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10365657, 10435085, 10687135, 10757353, 11459172, 11593332, 11714800, 11845255, 12184809, 12594285, 1314129, 1423301, 1450408, 15333750, 16224276, 16304057, 1642399, 1643431, 17106244, 18289047, 18388930, 18593361, 19242529, 19737959, 20670430, 20948441, 21518728, 2159436, 22130161, 22706381, 23369684, 23661160, 23677467, 24907378, 24971746, 24973616, 25736262, 27697858, 27757560, 27875387, 28000528, 28193627, 28282548, 28315535, 28344662, 28434398, 28614908, 28746871, 28929820, 29165819, 29187357, 29405038, 29843822, 30017877, 30053905, 30154648, 30303516, 30318089, 30342473, 30373602, 30397036, 30415086, 30611319, 30626941, 30664008, 30698174, 30718426, 30963193, 31108244, 31566658, 7584072, 7703441, 7833372, 7919965, 8054375, 8099724, 8260705, 8314354, 8338879, 8386711, 8439968, 8562498, 8869681, 8930655, 9131386, 9151215, 9158940, 9182821, 9222277, 9316052, 9322873, 9336741, 9456431, 9605179, 9652756, 9742914, 9816095, 9816229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	10382738, 11125310, 11459172, 11714800, 11845255, 11924911, 12080146, 12610520, 12806273, 12843795, 15471828, 15944290, 16615096, 17106244, 18388930, 19085934, 19651643, 20564107, 2059968, 21631324, 22027907, 22130161, 22467596, 22932225, 24204708, 2423240, 25205170, 27741090, 2784715, 28222797, 29948616, 32152202, 3262710, 35013003, 36923304, 37229906, 6331928, 6602860, 7627996, 7919341, 7923247, 8006445, 8044827, 8175709, 8205560, 8287599, 8706345, 8869681, 9067406, 9182821, 9222277, 9652756	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	11714800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	12374674, 12439608, 15577323, 15917704, 16131448, 16248763, 16260693, 16432458, 16809738, 16939954, 17023156, 17105418, 17576460, 17709802, 17761969, 18176117, 18281670, 18298334, 18332650, 18999936, 19243244, 20423231		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	15250044, 18467720, 19238009, 21955245, 23284620, 2381442, 25615005, 8567975, 9756417	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	8642353	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	19473628		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	8450337		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	11793857, 26934083, 28918107, 30314474, 30405261, 30711869		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28486207		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36901697	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19155997	Inhibit	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	11714800, 11896446, 11924911, 12806273, 16179868, 1642399, 16638862, 18388930, 21577143, 21955245, 23244384, 2381442, 24907378, 25695689, 25806780, 27623136, 27875387, 28008452, 28282548, 28719434, 28929820, 29254506, 29721378, 30053905, 30073390, 30100988, 30342473, 30605822, 30611319, 30673115, 30747243, 30777131, 30974014, 31108244, 31160329, 31422446, 7919965, 8054375, 8338879, 8642255, 8712798, 9322873, 9578425, 9742914, 9759882, 9816229		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30761160		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	37938611	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29248892		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	18268282		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	19766059, 28648621, 31317282		★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	1568183		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29611101		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29664031	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10233729, 32884012	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	24903211, 38273388	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28081636, 9790317		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	12108676		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10891455, 12181045, 14717778, 20651070, 27983725, 29089645, 30872779, 36105747, 36189306	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11368448, 27492707, 28201977, 28871325, 29982719, 8892624		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11698282, 23232072	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10193428	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10626674, 11525806, 12358847, 12409183, 14975604, 18612409, 18650128, 19119414, 19155502, 19231135, 19523143, 19543959, 19701192, 20042183, 20179739, 20450971, 20594918, 22488447, 2353574, 24919928, 25278028, 28094337, 28450896, 28641771, 28803486, 29153546, 31167379, 31242590		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17439892, 18755820		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18612409, 18769633, 20179739, 20594918, 21875375, 2458871, 25148387, 29518260, 3085102, 31167379, 35173329, 39201794	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24376757	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31421627		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	31123295	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	30054161, 31004723, 31156792		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	11712854, 18533277, 19693092, 28671717, 29718870, 30729267, 31348521, 8583224		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	30945700, 9867130	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	10903801, 8027577	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	18245523	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	18268282, 28113084		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11122147, 18268282, 2955819, 32739457	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11775253, 11996791, 1691935, 23057733, 24574458, 26607600, 29023488, 3099099, 3881192, 8457470		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29980186, 30619280, 31444669		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	1776975	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28260995	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11133172, 30224390		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	1835892, 39946176	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30604316		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	35393495	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	27821550	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22959364		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	38022554	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	28034070		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10197635, 12133300, 20438365		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	12536237	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28207826	Stimulate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	33239013	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	10389944		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10090303, 10190313, 10232603, 10365657, 10378889, 10385645, 10389944, 10435085, 10473807, 10490962, 10499605, 10506635, 10566144, 10608345, 10680837, 10697552, 10724038, 10731923, 10773410, 10838662, 10854152, 10870026, 10903801, 10933975, 10965493, 10981668, 11023199, 11023201, 11069717, 11076653, 11206268, 11265641, 11387054, 11477452, 11545616, 11593332, 11713398, 11752714, 11775545, 11810184, 11836582, 11836673, 11924909, 11948133, 11961669, 12133269, 12174877, 12184809, 12217197, 12470652, 12483109, 12521324, 12534360, 12542845, 12554523, 12601393, 12609842, 12707056, 12806273, 12815341, 12827309, 12839930, 12865933, 1331177, 1396583, 14502228, 1450408, 14504825, 1457368, 1457511, 14648071, 14675394, 14978762, 1502188, 15115782, 15147038, 15170886, 15250044, 15287090, 15294176, 15337523, 15373345, 15448033, 15515141, 15517589, 15517867, 15645128, 15744147, 15897568, 1601521, 16153160, 16230419, 16309178, 16339517, 16354199, 1642399, 16621991, 16714222, 1679414, 17021139, 17332365, 17600469, 1790142, 17929011, 18227840, 18370214, 18398504, 18444786, 18473731, 18538434, 18813797, 18830208, 18837910, 18979278, 19088026, 19402069, 19514839, 1951632, 1968360, 19762283, 19788391, 19924441, 20049409, 20227890, 20624956, 20858484, 20948441, 21248148, 21258414, 21282337, 21344541, 21424118, 21426339, 21889762, 21905822, 21971587, 2212951, 22143801, 22242968, 22291136, 22303460, 22576348, 22699929, 22706381, 22996231, 23028547, 2305833, 2307225, 23124508, 23443963, 2347603, 23661160, 2404283, 24097874, 24169587, 24174378, 24613899, 24645750, 24935593, 25108500, 25292096, 25368243, 25472998, 25582080, 25695689, 26141233, 26179662, 26266810, 26303327, 26387951, 26501438, 26928703, 27151235, 27174862, 27247421, 27297552, 27697858, 27720718, 27736965, 27742794, 27793775, 27824739, 2783560, 27858101, 27899275, 27924972, 28052202, 28116088, 28166182, 28166197, 28197364, 28363475, 28405498, 28448867, 28473400, 28492521, 28496990, 28501941, 28513532, 28549917, 28586006, 28614908, 28646117, 28669340, 2874115, 28754817, 28900509, 28916655, 28927416, 29042284, 29115604, 29140228, 29163482, 29174440, 29187357, 29254506, 29317734, 29327244, 29328445, 29463551, 29511983, 29517678, 29550799, 29577276, 29618524, 29635899, 29662489, 29691298, 29691476, 29701680, 29721366, 29752720, 29758415, 29871814, 29872502, 30343514, 30397036, 30410056, 30415086, 30687269, 30718426, 30782667, 30808414, 30824549, 30831276, 30842160, 30858538, 30971453, 30988166, 31057396, 31059598, 31069147, 31114758, 31152624, 31189644, 3119325, 31348125, 31410060, 31455682, 31790729, 31799191, 3266610, 6607956, 7510989, 7521786, 7523315, 7578396, 7578421, 7594483, 7636270, 7757988, 7780612, 7842293, 7844602, 7848491, 7885036, 7919965, 7954840, 8039135, 8050820, 8054375, 8142173, 8169977, 8215637, 8242620, 8260705, 8338879, 8409397, 8423625, 8439980, 8458636, 8473752, 8509212, 8564954, 8609413, 8610141, 8623798, 8628012, 8642255, 8656246, 8664053, 8712732, 8712798, 8725882, 8816835, 8818648, 8826937, 8930655, 8940638, 8953312, 8954146, 8978294, 9020917, 9023415, 9080118, 9151215, 9156803, 9171230, 9180138, 9185703, 9192768, 9212240, 9259972, 9270021, 9336744, 9373351, 9414257, 9439686, 9449371, 9456431, 9476965, 9498799, 9551618, 9570303, 9573023, 9588898, 9610908, 9649178, 9661877, 9667056, 9731068, 9759882, 9766562, 9813669, 9813672, 9816091, 9816229, 9824634, 9864400, 9924696, 9935185		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	12579325		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	2365829		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	6319491		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	30721117		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	20420800		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	20420800		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	9180296		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	1803038	Inhibit	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	15200413, 1803038	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	CTD_human_DG	19242727		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	20446793	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	21525574		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nervous System Diseases	Nervous system disease	Pubtator	2367534	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	7507498		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10731923, 12406881, 15125707, 15953676, 17332365, 17471169, 17595664, 18833006, 19737959, 20145545, 20935224, 23661160, 23719242, 24097874, 29327110, 31358541, 31455682, 7627815, 8640845, 8793547, 9476965, 9650615, 9731051		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12406881, 20935224, 29327110, 35839426, 9731051	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25197660	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28003243, 31123295		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	20049409		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	27448806	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	17606879		★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	17606879		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	30524320		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	2945603	Associate	★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	17900685		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	16353293		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28471828		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24935593, 28715437, 30619280, 31381177		★☆☆☆☆ Found in Text Mining only
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	28302535		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30836740		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21736829, 33004937	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28243360, 28840653, 31269440, 31824482		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28963085	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33094626	Stimulate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	2395860, 8530186		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	2395860	Associate	★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	15920464		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	26722428, 31049005		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	21845339		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	21845339	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33362761	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33879632, 9665944	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	19860911	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25384921, 37949959	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	40496565	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10770626, 28321811, 29187458		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10849374	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	26957492		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15214947		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	34360900	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	2037104, 31331391		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	25424734, 31040646		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	25424734	Stimulate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11780319, 21725665, 27035425, 8623798		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	1387344, 20870202, 31388197, 35464051, 36276992, 37155466, 7648722, 8439980	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	3128500	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37322531	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	28239463		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10404069, 26849077, 31114758, 9185703		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18676770		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28614908		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37455016	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	7919341	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	29455176		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	12715014	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	29241050		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25294906		★☆☆☆☆ Found in Text Mining only
Papillon-Lefevre Disease	Papillon-Lefevre Disease	BEFREE	16410452		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	23487197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paranoid Schizophrenia	Paranoid Schizophrenia	PSYGENET_DG	23487197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	17409595, 21208912, 31402625, 33767694	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	1982452, 2367534	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26911448, 27230441, 31123295, 34536521	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36301901	Stimulate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	7524616		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31114758		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	11529927, 8455368		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	30150979		★☆☆☆☆ Found in Text Mining only
Pelger-Huet Anomaly	Pelger-Huet Anomaly	BEFREE	30502647		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	11161984		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pemphigus	Pemphigus	Pubtator	16946717, 6432916	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peptic Esophagitis	Peptic Esophagitis	BEFREE	18192685		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	12354082		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	22984628, 31978095	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30573746, 8608641		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30021515		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30021515		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	20439541, 24376268		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34360900	Inhibit	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	8712732		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	2169997		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	27345569		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31148852		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32785222, 33094626	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34646235	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	22965887	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	12147628, 31669890		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	21714072		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	25337274		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	2148811, 25337274		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	11924909, 1351762, 2243505, 2578514, 26984209, 6982237		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	1405755, 2383656, 2546621, 26549032, 29966986, 7885036		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	2037104, 31331391		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	10634216, 15880308, 26347073		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	18573422	Stimulate	★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	6319491		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	21304239, 22554193, 26347073, 27965154, 29698570		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	31123295		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31608440		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11387054, 15076142, 17115417, 20184734, 29441606, 30761160		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	12920242	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17115417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17115417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17115417, 20184734, 21943235, 23754304, 30761160, 36627144	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24619696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudo-Hurler Polydystrophy	Pseudo-Hurler Polydystrophy	BEFREE	2931446		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	10228632, 18245523	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	17714919, 18245523, 19201773, 21375519, 27554821, 28110689, 31062065, 8027577		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	17714919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	19201773, 7923918	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychosis, Involutional	Psychosis	CTD_human_DG	12635532		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30836740		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28648519		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19279357, 26498252, 33223825, 37083575	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28963085	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	34483727	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29601941		★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	6319491		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	30405261		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	12165096		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	1423266, 15897568, 16304057, 17571248, 21387109, 21577143, 24907378, 28000528, 29453736, 7521786, 9742914		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10388747, 10854152, 11691814, 12815341, 16635513, 17206887, 1790142, 18317356, 19128501, 1968360, 19810129, 20168351, 21258414, 22303460, 22715591, 23677467, 23867518, 24727990, 24895689, 25736261, 27916626, 28056941, 28315535, 28321811, 28341412, 28344662, 28448047, 28939740, 29443657, 29460635, 29520448, 29691298, 29728867, 30342473, 30343514, 30415086, 30710374, 30777131, 30848378, 31160329, 7521786, 7523315, 7584072, 7591233, 8325704, 8341057, 8423625, 8443817, 9610908, 9723777, 9742914		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17457216		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30721117		★☆☆☆☆ Found in Text Mining only
Residual Tumor	Residual Tumor	CTD_human_DG	14654953		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30755248		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	7813103	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	20484443, 34987646	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	23395551		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	9918768		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23797008	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	40226625	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10209065, 10503562, 10733472, 11056676, 11238664, 12030433, 12165096, 12571841, 12610796, 1462123, 15895884, 1660155, 17396252, 1747947, 18369459, 18650128, 19302705, 19404967, 2016122, 20553587, 2113447, 21875375, 24098138, 25429725, 26149185, 26917059, 29379122, 30001644, 30143591, 30413189, 30800133, 31366819, 3263464, 3486288, 7882553, 8181523, 8207227, 8216416, 8318038, 8674237, 8961900, 9032818, 9292788, 9433869, 9771211, 9818646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Roberts Syndrome	Roberts syndrome	Pubtator	33319833	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	11745487		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10418818, 11035116, 28295528, 31063909, 31622413, 3491139, 3496388, 9032124, 9311498		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	11091281, 18654018, 9311498	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21177920, 23630356, 3138285, 7929830	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	1477028, 3138285	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	1988368, 28716814		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30963193	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	15541084		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16091861, 18574615, 20926141, 24065520, 24564241, 28476335, 31123247, 31446217, 8546160, 9075278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	16091861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20926141, 23487197, 24564241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24564241	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29803226	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleritis	Scleritis	BEFREE	17496900		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	10227811, 17195236		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	23172754	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	11710721, 23172754	Associate	★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	8450029		★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	28843235	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	27829339		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	32996896	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21711552, 22627572, 29907868, 30547887		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	17052299, 18178835		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	30139310		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10374907, 11044908, 11468191, 19089604, 2139699, 24856896, 2497184, 25042067, 26550777, 27269786, 28209722, 29102562, 30957314, 7668284, 7829104, 7849738, 7860773, 7937790, 8070818, 8400297, 8781427, 8916956, 8956936, 8986719, 9150730, 9307981, 9801259, 9933465		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	11468191, 12435740, 2139699, 2787027, 8506326, 8986719, 9933465	Associate	★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency, atypical	Severe combined immunodeficiency disease	BEFREE	29948574		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	30943938		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	10491012, 14695224, 21938013, 24621498, 27329723, 6237693, 9129044		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	27329723, 6237693, 9129044	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	35533722	Inhibit	★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	24406074		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	22403659		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30150979	Inhibit	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31086200	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35705251, 9867125	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	10504456, 2142183	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10504456, 2142183, 2487682, 25672756		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	19452503	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	2169997, 31381177, 8386711, 8795583, 9415308		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34006632, 36879122	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	10491011, 2367534		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	1747947, 2016122, 30413189		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	2016122, 23317891	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11023201, 12124336, 7523315, 7594483, 9178640, 9815891		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21258967, 29683892, 9178640		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16309178	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21264308	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10773410, 1535088, 15744147, 16309178, 17929011, 18813797, 21845339, 8242620		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	18628433		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	15963390		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	23244384, 28008452, 30073390, 30342473, 9578425		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	15200413		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	15200413, 15356430		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11309652, 18761558, 28111424, 28458166, 28901504, 30071135, 7594483, 7622194, 8004819, 9212240		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10333716, 14695763, 15361708, 2498249, 2522349, 28111424, 32086862, 8004819	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15904474		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35673992	Associate	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	31123295	Stimulate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	29680372		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10227811, 17195236, 17444587, 18576303, 23172754, 30150979, 31320847, 7882553		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	17444587		★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	30353031, 9403005		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11021818, 11453809, 11587224, 1396583, 1675581, 18296860, 1840490, 24218456, 30242208, 30340635, 9021695, 9858215		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	17002904		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	26250536	Associate	★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	15001467		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	19617815	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	11149427, 19693092, 2578514		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	12608932, 19798110		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31159823, 32348468	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12534360		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	2390468	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	29131274	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12534360		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	2390468	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	1997108, 2390468	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	2505957, 2992637	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	10070868		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	16378732		★☆☆☆☆ Found in Text Mining only
Trifunctional Protein Deficiency With Myopathy And Neuropathy	Trifunctional protein deficiency	Pubtator	11918852	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21308409, 30294328		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35377948	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10844519, 14652292, 15039318, 1568572, 15827446, 19201773, 19455118, 19471255, 20197757, 21304239, 21425313, 21648020, 27622899, 28685527, 31002701, 7820201, 8050181, 8425687, 8436398, 9697979, 9741021, 9928390		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	2135065, 30314474		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	29257244		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10375787, 1764393, 34858395	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19924441, 8044829	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Retention	Urinary retention	Pubtator	26250536	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	39684873	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18628433, 21370592	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17222831, 31148852		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	18296654	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22429778	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29757889		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	10469047	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	17496900, 21905024, 28468317		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	32479651	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	10361227	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	14977779	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	25303043, 3493846	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	28166182		★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal Neoplasms	CTD_human_DG	15577323		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vaginitis	Vaginitis	BEFREE	30612085		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12727483		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22129253, 31740549		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	22129253	Inhibit	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	25634360	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	8698322	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	24662764, 25029322	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	29052782, 29254506, 29504235, 31172649, 9131386		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	29052782, 29254506, 29504235, 31172649, 9131386		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	29246578	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	2395860, 8530186		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	LHGDN	15001467		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	17082665, 28232030		★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	10889304, 11319919, 12857971, 14966353, 17369490, 18688285, 19286997, 19398866, 21889323, 22551777, 25042067, 25443657, 7481768, 7557965, 7632950, 7803808, 7829103, 7829104, 7860773, 7865464, 7937790, 7946053, 8027558, 8299698, 8571541, 8605322, 8605323, 8676091, 8712778, 8750273, 8781427, 8956936, 9005984, 9399950, 9479568, 9716584, 9801259, 9921912, 9933465		★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	29322139, 30296293		★☆☆☆☆ Found in Text Mining only