IL1RN (interleukin 1 receptor antagonist)

Gene

• Entrez ID: 3557
• Gene name: Interleukin 1 receptor antagonist
• Gene symbol: IL1RN
• Synonyms (NCBI Gene): CRMO2, DIRA, ICIL-1RA, IL-1RN, IL-1ra, IL-1ra3, IL1F3, IL1RA, IRAP, MVCD4
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs112879651	C>G	Likely-pathogenic	Intron variant, stop gained, coding sequence variant
rs121913161	G>T	Not-provided, pathogenic	Stop gained, coding sequence variant
rs121913162	C>T	Not-provided, pathogenic	Stop gained, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437581	hsa-miR-125a-5p	Microarray, qRT-PCR	22815788
MIRT1064430	hsa-miR-1	CLIP-seq
MIRT1064431	hsa-miR-1269	CLIP-seq
MIRT1064432	hsa-miR-1269b	CLIP-seq
MIRT1064433	hsa-miR-1275	CLIP-seq
MIRT1064434	hsa-miR-1288	CLIP-seq
MIRT1064435	hsa-miR-129-5p	CLIP-seq
MIRT1064436	hsa-miR-1321	CLIP-seq
MIRT1064437	hsa-miR-1827	CLIP-seq
MIRT1064438	hsa-miR-206	CLIP-seq
MIRT1064439	hsa-miR-2682	CLIP-seq
MIRT1064440	hsa-miR-31	CLIP-seq
MIRT1064441	hsa-miR-3126-5p	CLIP-seq
MIRT1064442	hsa-miR-3150b-3p	CLIP-seq
MIRT1064443	hsa-miR-34a	CLIP-seq
MIRT1064444	hsa-miR-34c-5p	CLIP-seq
MIRT1064445	hsa-miR-3614-5p	CLIP-seq
MIRT1064446	hsa-miR-3663-5p	CLIP-seq
MIRT1064447	hsa-miR-3673	CLIP-seq
MIRT1064448	hsa-miR-3688-5p	CLIP-seq
MIRT1064449	hsa-miR-4300	CLIP-seq
MIRT1064450	hsa-miR-4419a	CLIP-seq
MIRT1064451	hsa-miR-4455	CLIP-seq
MIRT1064452	hsa-miR-449a	CLIP-seq
MIRT1064453	hsa-miR-449b	CLIP-seq
MIRT1064454	hsa-miR-449c	CLIP-seq
MIRT1064455	hsa-miR-4510	CLIP-seq
MIRT1064456	hsa-miR-4515	CLIP-seq
MIRT1064457	hsa-miR-4648	CLIP-seq
MIRT1064458	hsa-miR-4654	CLIP-seq
MIRT1064459	hsa-miR-4665-5p	CLIP-seq
MIRT1064460	hsa-miR-4739	CLIP-seq
MIRT1064461	hsa-miR-4740-5p	CLIP-seq
MIRT1064462	hsa-miR-4747-5p	CLIP-seq
MIRT1064463	hsa-miR-4756-5p	CLIP-seq
MIRT1064464	hsa-miR-4769-5p	CLIP-seq
MIRT1064465	hsa-miR-4784	CLIP-seq
MIRT1064466	hsa-miR-490-5p	CLIP-seq
MIRT1064467	hsa-miR-613	CLIP-seq
MIRT1064468	hsa-miR-920	CLIP-seq
MIRT1064469	hsa-miR-103b	CLIP-seq
MIRT1064470	hsa-miR-148a	CLIP-seq
MIRT1064471	hsa-miR-148b	CLIP-seq
MIRT1064472	hsa-miR-152	CLIP-seq
MIRT1064473	hsa-miR-371b-3p	CLIP-seq
MIRT1064474	hsa-miR-4313	CLIP-seq
MIRT2015331	hsa-miR-103a	CLIP-seq
MIRT2015332	hsa-miR-107	CLIP-seq
MIRT2015333	hsa-miR-1299	CLIP-seq
MIRT1064437	hsa-miR-1827	CLIP-seq
MIRT2015334	hsa-miR-3612	CLIP-seq
MIRT2015335	hsa-miR-4443	CLIP-seq
MIRT2015336	hsa-miR-4782-5p	CLIP-seq
MIRT2015337	hsa-miR-516b	CLIP-seq
MIRT2015338	hsa-miR-650	CLIP-seq
MIRT2247668	hsa-miR-205	CLIP-seq
MIRT2247669	hsa-miR-3199	CLIP-seq
MIRT2247670	hsa-miR-4505	CLIP-seq
MIRT2247671	hsa-miR-4652-5p	CLIP-seq
MIRT1064461	hsa-miR-4740-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	20032313
RELA	Activation	20032313
STAT3	Activation	20032313

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IDA	2137200
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005150	Function	Interleukin-1, type I receptor binding	IPI	1828071
GO:0005151	Function	Interleukin-1, type II receptor binding	IPI	1830582
GO:0005152	Function	Interleukin-1 receptor antagonist activity	IBA
GO:0005152	Function	Interleukin-1 receptor antagonist activity	IDA	2137200, 2139180
GO:0005152	Function	Interleukin-1 receptor antagonist activity	TAS	7629520
GO:0005515	Function	Protein binding	IPI	9062194, 21044950, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2137200, 9185517, 10443688, 12483741
GO:0005615	Component	Extracellular space	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006953	Process	Acute-phase response	IDA	9185517
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	7629520
GO:0007165	Process	Signal transduction	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0031982	Component	Vesicle	IEA
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	2139180
GO:0045352	Function	Interleukin-1 type I receptor antagonist activity	IDA	1828071
GO:0045353	Function	Interleukin-1 type II receptor antagonist activity	IDA	1830582
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:2000660	Process	Negative regulation of interleukin-1-mediated signaling pathway	IBA
GO:2000660	Process	Negative regulation of interleukin-1-mediated signaling pathway	IDA	2137200, 2139180

Other IDs

• MIM: 147679
• HGNC: 6000
• e!Ensembl: ENSG00000136689

Protein

• UniProt ID: P18510
• Protein name: Interleukin-1 receptor antagonist protein (IL-1RN) (IL-1ra) (IRAP) (ICIL-1RA) (IL1 inhibitor) (Anakinra)
• Protein function: Anti-inflammatory antagonist of interleukin-1 family of proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Protects from immune dysregulation and uncontrolled systemic inflammation triggered by IL1 for a range
• PDB: 1ILR, 1ILT, 1IRA, 1IRP, 2IRT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00340	IL1	60 → 173	Interleukin-1 / 18	Domain

• Tissue specificity: TISSUE SPECIFICITY: The intracellular form of IL1RN is predominantly expressed in epithelial cells.
• Sequence:

  MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
  QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD
  KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

• Sequence length: 177

Pathways

KEGG:

Cytokine-cytokine receptor interaction

Reactome:

Interleukin-10 signaling
Interleukin-1 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoinflammatory syndrome	Likely pathogenic	rs2104433206	RCV002264623	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer susceptibility after h. pylori infection	Pathogenic	rs2234663	RCV000015787	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IL1RN-related disorder	Likely pathogenic	rs1011480433	RCV003412253	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Interstitial lung disease 2	Likely pathogenic	rs763872895	RCV000677223	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant tumor of urinary bladder	Likely pathogenic	rs763872895	RCV005901564	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microvascular complications of diabetes, susceptibility to, 4	Pathogenic	rs2234663	RCV000015788	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Sterile multifocal osteomyelitis with periostitis and pustulosis	Pathogenic; Likely pathogenic	rs672601268, rs1019766125, rs2466916722, rs121913161, rs121913162, rs2466916551, rs2466945415, rs763872895, rs1340890598	RCV001857408 RCV002653788 RCV003516199 RCV000015789 RCV000015790 RCV003630424 RCV004006257 RCV000779276 RCV000818103	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTHRACOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, GOUTY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC MULTIFOCAL OSTEOMYELITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RECURRENT MULTIFOCAL OSTEOMYELITIS 2, WITH PERIOSTITIS AND PUSTULOSIS	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON COLD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL NEOVASCULARIZATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRESCENTIC GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DACRYOCYSTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTHYMIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXANTHEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRAVASATION OF DIAGNOSTIC AND THERAPEUTIC MATERIALS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC-UREMIC SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HENOCH-SCHOENLEIN PURPURA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS, DENDRITIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS, HERPETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHIC OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS, CALCIUM OXALATE, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS NECROTIZING	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	19026124		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	20630038		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	20630038		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	12374626		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	15670034, 20709104, 29395365		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	31709864		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23014359		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	10766448, 11331456, 29117667		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19322919		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11920517, 7989495		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	8930557		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	15730917		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	25665855		★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	18180150		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	12445219, 12919285, 18723088, 20335539		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	14533660		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	11841485, 11841553, 23584371, 8077705		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	11841485, 11841553, 23584371, 8077705		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	LHGDN	11841553		★☆☆☆☆ Found in Text Mining only
Alopecia totalis	Alopecia	BEFREE	11841553		★☆☆☆☆ Found in Text Mining only
Alopecia universalis	Alopecia	BEFREE	11841553		★☆☆☆☆ Found in Text Mining only
Alopecia universalis	Alopecia universalis	Pubtator	8077705	Associate	★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	BEFREE	10934117		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	18403674		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15201366, 22498095	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23186989	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	19764937, 22498095		★☆☆☆☆ Found in Text Mining only
Amyloid nephropathy	Amyloid Nephropathy	BEFREE	17336710		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	19026124, 29174415		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24014495		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	24014495	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	17373677	Associate	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	31236065	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	11752505, 12468823, 12847695, 16206345, 16361275, 17899305, 21962386, 22285486, 23765978		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	33238942	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	CTD_human_DG	25392278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anthracosis	Anthracosis	CTD_human_DG	20005085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	29898582		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29898582		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31583844		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25726324	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	16268484, 29884291		★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11073843, 19574724, 30702995		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	21768915		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10192503, 10921508, 11094434, 11665981, 11840694, 12220548, 12645941, 12907945, 15452879, 16793145, 18060042, 18500247, 18569390, 21859345, 23006786, 23689131, 27804999, 28645307, 29481574, 31101752, 31599092, 9153551		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33480001	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	11665981, 29609200	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10366101, 1386877, 1395121, 14672890, 16200608, 16436009, 16885604, 17223662, 17593860, 18986219, 24014495, 25726324, 26314565, 27105431, 2827831, 29226727, 31376255, 31852669, 33674349	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15939878, 7763113	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31320744	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	21671260, 26521731, 28411044, 8507219		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10843772, 11027520, 12938145, 15020290, 16409203, 17107994, 18763028, 18810365, 18926055, 21252117, 23602199, 28340863, 28822267, 31550242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	12938145, 17107994, 25616863, 32204425, 35791991, 8870701	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15020290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	38253462	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	9176529		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10654577		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11073843, 19574724, 30702995		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12624309		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19574724, 21827714, 34122426, 37173673	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	23713812		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	11803448, 15365221		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31228728		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	11803234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	10498633, 30735937		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11127488, 16885604, 24328419, 29620037, 40076479	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11665981, 11727511, 12220548, 12609525, 17867984, 24328419, 27007229, 28645307, 29620037, 9646842, 9678537		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	GENOMICS_ENGLAND_DG	19494219		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	21480187		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26448050		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10870116		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	11427627, 17907045		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35328735	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12730545, 17211678, 23633568, 24252048, 28588495		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18455629		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15318032, 23406623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15318032, 23406623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16698387, 19489682, 24850227		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19494218, 28682145	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	23917160		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	32024452	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	24046817		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	9236716		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12451035, 14634505, 16319982, 19267917, 19544973, 22595751, 29047186, 30563983, 30987700		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19267917, 23991131, 24670917, 32977823, 36766731	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	14754758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	16409203, 31550242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	Pubtator	10515411	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	23551418		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	15539764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	27957795, 31354700		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30969811	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	31440247		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19904560, 27340011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10496524, 27340011		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29802240, 36292719	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34897107	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16698387, 19489682, 24850227		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16019127, 16126303, 21252117, 29463257		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	14504049	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31672677, 35395492, 39969214	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32469992	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11740709, 12530098, 14504049, 14652282, 18329282		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17002905, 17948066		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17948066	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	22447464	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	17948066, 19811434		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21814463, 28428221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carditis	Carditis	BEFREE	27400406		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	12624309		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	20536609	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	20536609	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12624309		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21607540	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	28370589		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	14672890	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37694725	Inhibit	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	19900796, 29943912		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	10529471, 12901853, 27530114, 27856349, 28602833, 29567761, 9099804		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	16980335, 25726324	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	20536609	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	27068409		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	12374626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	12686792, 16879054, 16980335, 17332449, 19811433, 22425140, 22744645, 24233813, 24680088, 25917615, 26860727, 27856349, 28602833, 29650950, 30355103, 7790404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	15036607, 16879054, 17332449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	17332449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	17332449	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	12530098, 12820354, 18008080, 18333945, 23053980, 24712845, 24905619, 25925136, 7594609		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	12530098, 12820354, 18008080, 18333945, 23053980, 24712845, 24905619, 25925136, 7594609		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	34592495	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	17107994		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	18940468		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	18940468		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	11001075, 11841553, 24014495, 8077705	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	17763411, 21792839		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15717635, 15954918, 16766392, 17176440, 17224277, 20551628, 9067916		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15717635, 17224277, 22795294, 28877949		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10870116		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	11001075, 12952260, 15766560, 18579366, 19608716, 21814463, 24504887, 25174605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15766560		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	18321309, 20934174, 23592003, 24612355, 25710474, 27068409		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23592003, 24612355, 25710474, 29023524, 30760334	Associate	★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	12804791		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	14986816, 15730917		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	7637259		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30688042	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23636052, 30779979, 8119534		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10673296, 30417021, 7586694	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	9414973	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12096923, 16006751, 29062241		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	18987561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16006751, 16142351, 19104506, 23192617, 30382562, 30723583		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11920517		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11920517, 26208990, 30593746, 31339548, 32671985, 34930323, 39766795	Associate	★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	BEFREE	19717455		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28587352		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	19010416		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	31785499		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29141858		★☆☆☆☆ Found in Text Mining only
Continuous Muscle Fiber Activity Hereditary	Hereditary continuous muscle fiber activity	Pubtator	10732829	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28915570		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	30156862		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10027806, 11740709, 11796541, 11816697, 12453918, 15943888, 19574724, 24233813, 25726324, 29395365		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10027806, 11527622, 11740709, 11816697, 12453918, 12551827, 14575520, 15051633, 15943888, 19142372, 21840356, 24233813, 25726324, 27078871, 29395365		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11527622, 19142372, 32223966, 37304261	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	38357816	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	15121769, 24233813, 25726324	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	37941911	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10027806, 11740709, 11816697, 15943888, 19053923, 23029154, 24233813, 25726324, 29395365, 31785499		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	15379752		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	11127457, 11514491	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10192196, 10500062, 11686217, 11740709, 11742191, 12424621, 12468823, 15803022, 16804398, 18942754, 19643686, 24776844, 25466956, 26316104, 7586694, 7809109, 8119534, 8723412, 8899101, 9014770, 9219791, 9414973, 9771403		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	16109659		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28269885, 30417021, 7586694, 7809109	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	38201264	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	LHGDN	16596202		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	18347298		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31788049		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10515411	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	12547728		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	12547728	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26972847, 31524632		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11083263, 12671514, 12734885, 1386092, 1458286, 14724685, 15190266, 16934183, 17532232, 18808736, 19036616, 19151976, 19733643, 19934104, 20131253, 20407468, 20592454, 20733349, 21523343, 21671260, 21798287, 23216199, 27654963, 28411044, 29608232, 29869535, 29869540, 30044894, 30070147, 30280295, 31034242, 31125271, 31291980, 31755595, 7593634, 9616438		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	15077300		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	24446526		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	19269948, 23385102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	PSYGENET_DG	19269948, 23385102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	BEFREE	12909295, 15201366, 31414991		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	21968104	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	30803280	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	25976322	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29520075		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	26171980	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	18416755, 29203183		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	22127713	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	16185275, 20631729	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	19706048		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12828754, 20920411		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338, 7706905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	10732829	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15141093, 15187412, 17097645, 17944678, 19396427, 21205020, 21499838, 26502861, 29346597, 29520075, 8786086		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	29760307	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15141093, 15187412, 17097645, 17944678, 19396427, 21205020, 21499838, 26502861, 29345164, 29346597, 29520075, 8786086		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15141093, 21205020, 38241313	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34566972	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19127455	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19127455, 23494449, 28143555, 7605869	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15141093, 17429083, 19542207	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21205020, 22606001, 24969107, 25726324, 26420861, 31142858, 32470060, 35460250, 38049854	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21289232	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10671304, 18853133, 19127455, 26502861, 28143555, 7605869, 7926295		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12453918, 15286433, 17069782, 17286233, 17429083, 18386294, 19541594, 20588114, 21289232, 24969107, 25491100, 27572239, 29425823, 29444430, 29471132, 29525039, 30693534, 31142858, 8786086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12453918, 15286433, 17069782		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32733443	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35663044, 9067916	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15286433, 17286233, 9067916		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15286433		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28556866		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	21712624, 31785499		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	21712624	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	11531943, 12105837, 12788304, 14632761, 15610073, 16164697, 16183821, 16550552, 17295877, 18761558, 19804405, 23800434		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	11531943	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	LHGDN	15610073		★☆☆☆☆ Found in Text Mining only
Dyskinesia Familial with Facial Myokymia	Dyskinesia, familial, with facial myokymia	Pubtator	22940634	Associate	★☆☆☆☆ Found in Text Mining only
Dysthymic Disorder	Dysthymic Disorder	BEFREE	14997019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysthymic Disorder	Dysthymic Disorder	PSYGENET_DG	14997019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eclampsia	Eclampsia	BEFREE	12044341, 23013217		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12828754, 20920411		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	18986219	Inhibit	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	33936110	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	14753487		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	20087638		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	1832651		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	1832651		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11665666, 1371258, 22509941, 25935859		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	1371258, 36028805	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	17292896		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37657716	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16860990		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	10805326, 19066720		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	14504049, 14652282		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17611673, 18396210, 30995661, 31102307		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18396210, 30995661, 31102307		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31102307	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31339548	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	14750640, 15842572		★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	15541451, 17336710, 29282807		★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	31331109		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37657050	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	22027586, 23661906		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	15730917		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	20486195, 26813462, 27240522, 27871023, 28296777		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17222831		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11045853, 23661906, 30875826, 9622392		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	16860990		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	31755595		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	18940468		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15307635, 28058586		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	15885804, 18761558		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	12105837, 18047563, 18385937, 25292060, 28110439		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	25292060	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	20482626, 27340011	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	12854083, 15247172, 20482626, 20631624, 27340011		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	15236174, 19603010, 23806268		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	10400826	Associate	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	12919285		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	19026700		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	20399384, 26097611		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	15830637, 17448214		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	35872944	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	12913327		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	8120140		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	8120140		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30978442		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	9186886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	10916103, 11849463, 9186886	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	9263995	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	9263995	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	CTD_human_DG	18403674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	35501419, 39568029	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11380474, 12393699, 12930389	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	18814951	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12393699, 12930389		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	19010416		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10924276, 16025481, 17348243, 24446657, 24465880, 24840811, 29454070, 7530255, 8954062, 9678537		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	17348243, 17964974, 24840811	Associate	★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	10934117		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	24328419		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	24328419	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	17948066		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17948066	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29141858		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30941129	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	34685778	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	12044341		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	9186886	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoid	Pubtator	39766795	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	12136897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	10496524		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	20942594		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	12794527		★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	21792878		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29410009		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19396427, 27492721, 27572239		★☆☆☆☆ Found in Text Mining only
Hyperimmunoglobulinemia D	Hyperimmunoglobulinemia	BEFREE	18347298		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	10377182	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24233813	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11840488, 21840356, 31354700, 7946395		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	11840488, 17611547		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic generalized epilepsy	Epilepsy	BEFREE	31698971		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	CTD_human_DG	10886238		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	11092196		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10934117, 16573560, 17056243, 19117745, 22059992, 22322675, 7767546		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	17056243, 22059992	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10916103, 11849463, 12138282, 19280228, 24592969, 9186886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	17483707, 20626741, 21591983, 27007229		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23867674		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	18484169		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	23375040	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10192196, 10500062, 11040178, 11220627, 11600466, 11686217, 12424621, 16109659, 16638698, 19643686, 25466956, 31191826, 31567972, 7586694, 8899101, 9014770, 9219791, 9414973, 9568467, 9771403		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36643579, 7586694, 9771403	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory dermatosis	Dermatitis	BEFREE	18416755, 29203183		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24969107, 26420861	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25124963		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	25124963	Associate	★☆☆☆☆ Found in Text Mining only
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	ORPHANET_DG	19494218		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	GENOMICS_ENGLAND_DG	19494218, 19494219		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	BEFREE	21792839, 22127713, 22431714, 28503715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICIENCY	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	15077300, 16436110, 20581747		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	16436110, 17760968, 22863285	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	32319224	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	26198819	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	23053980		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	15247174	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	25073651		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	12686792, 15036607, 16980335, 17332449, 19811433, 20034444, 22744645, 24680088, 26860727, 29567761, 30075593		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	11665981, 12195624, 27717726, 29609200		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	8286744		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11001912		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	23462747, 24322806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Calculi	Kidney stone	BEFREE	17258699		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10049523, 15286433, 17069782, 17176440, 17286233, 20551628, 8786086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	16436009	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	9370186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	15286433, 16174285		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15717635, 15954918, 16766392, 17176440, 17224277, 20551628, 9067916		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	17224277		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disabilities	Learning Disorders	CTD_human_DG	25665855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	25665855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	25665855		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	21811191		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	17114844	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	19618085	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26610735		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23014359, 28411044		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36129940, 7730146, 7867645	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1373331	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1835893	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30026572	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	8286744	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1835893, 7629564, 8361209		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10496524, 16172101, 29802240, 9185517		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11045853, 14986816, 15730917, 20087638		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	19278365	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11171832, 1395121, 15884119	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19278365		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	17081566, 22844472		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	16771644, 20644519, 22844472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	CTD_human_DG	20644519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	9185517		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	12176706, 30095747		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	20404807	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32691471	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	7767546		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16126303		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34475499, 35381771	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11727511, 11740709		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15498048	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15535834, 16436009, 27412348, 31396542	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11727511		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10192503, 11727511, 12111633, 14672899, 14872281, 15535834, 17176440, 17596285, 23722873, 24055697, 25286391, 29422069, 7614783, 7639800, 7945503		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12111633, 17176440		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11727511		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	38077348	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18038187, 22524835		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17327408	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16596202, 18038187		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21250972		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	20682698		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	11466410, 17140157		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	29977033, 31513353		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed Syndrome	BEFREE	28301468		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27138824, 30662368, 31818803		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12451035, 14634505, 16319982, 19267917, 19544973, 22595751, 29047186, 30563983, 30987700		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	1832651		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18396210, 30995661, 31102307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18940468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30655809		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16019127, 16126303, 21252117, 29463257		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11740709, 12530098, 14504049, 14652282, 18329282		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16106254, 25374200		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16106254, 16284379		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12530098, 12788304, 12854083, 15233701, 15381184, 15540224, 15551344, 15800325, 15851404, 15878285, 15927855, 16114018, 16284368, 16985030, 17035400, 17096351, 17235630, 17295877, 17444864, 18047563, 18565646, 18628242, 18761558, 18779738, 18807132, 19607807, 20222161, 21243433, 22327782, 22714811, 23323013, 24080970, 24557417, 26632693, 28110439, 29344744		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16698387, 19489682, 24850227		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12530098, 14633943, 16019127, 16698387, 17006981, 1832651, 18565646, 18940468, 19082487, 20347291, 22744645, 25738940, 30953767		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12530098, 12820354, 18008080, 18333945, 23053980, 24712845, 24905619, 25925136, 7594609		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16006751, 29062241		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	18987561		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	29898582		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	29730395		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14522922, 16489061, 28885200, 31788049		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29377892, 31545456	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33057211	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29520075		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	19125864		★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	BEFREE	28815548		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20178882		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21205020	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21289232, 36597718	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20213597, 21205020, 21289232		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	20113413		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30541566		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	11287019, 15866604		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	10371542, 10871782		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18832862, 28815548		★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	17763411		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15900570, 21279638, 28390409, 29885546, 31099056		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15900570, 35699824, 38357816	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34035116	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	8703481		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	15339690		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10848780, 17926179		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10848780	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17926179		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10371542, 10685855, 10713369, 10871782, 11311293, 11498264, 12775358, 14664464, 16769128, 19876593, 20192980, 21621860, 21720720, 23052182, 23594042, 9357444, 9413274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12775358		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12775358, 33936066	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	25458313		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	25458313		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	9413274		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	9521608		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	31270105		★☆☆☆☆ Found in Text Mining only
Myhre syndrome	Myhre Syndrome	BEFREE	23610053		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11816697, 18703194, 20178882, 21199393, 29724623, 31077280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	18474815, 19005744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	35231061	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	37941911	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11796541, 23308180		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	11901035, 31099056		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	19822442	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	10732829, 10886238	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	BEFREE	10886238		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	CTD_human_DG	10886238		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis, Focal	Myositis	CTD_human_DG	10886238		★☆☆☆☆ Found in Text Mining only
Myositis, Proliferative	Myositis	CTD_human_DG	10886238		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	10732829	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23562526		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28013313, 28770467		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10496524, 11920517, 12051868, 12820354, 14504049, 14522922, 16489061, 19082487, 20844880, 21519029, 24998848, 25156255, 25738940, 27340011, 28885200, 29985074, 30273860, 30978442, 31102307		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	10566895		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	17258699		★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	18186699		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	9263995	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17316994		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	9325020	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	14754758		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	19010416		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16126303		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	22027586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	12716739, 14734209, 16318998, 17097645, 18386294, 19396427, 22027586, 29444430, 29584615, 31320744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16968396, 28293435, 34620218, 35139823, 39457458	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	32469992	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Odontogenic Tumors	Odontogenic Tumor	LHGDN	18624935		★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	BEFREE	17572155		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11083263, 12115182, 1395121, 14672890, 17532232, 19036616, 19934104, 20131253, 21671260, 23602982, 31852669, 33953899, 9616438	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15880595	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	38554643	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	17532232, 21671260	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	19934104, 20592454, 23216199, 23602982, 31852669, 36216277	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	19733643, 21146623, 21671260		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	12115182		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	15190266, 18808736, 19151976, 19934104, 20592454, 21146623, 21523343, 23602982, 9182910		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	21792839, 23917160, 28682145, 29912021		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	21792839, 28682145, 32454789	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10678408, 11040178, 11803396, 9763149		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	11740709, 12169981, 12240899, 12477576, 12568735		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	38567587	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10678408, 12240899, 9763149		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11740709, 12530098, 14504049, 14652282, 18329282		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18329282		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14504049	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	29117667	Associate	★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	LHGDN	15318032		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20427258, 29478949, 29540296		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	31440247	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	LHGDN	11448121		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	19470040		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	37763742	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	15236174		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	11531943, 12161099, 30320011		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	11531943, 19030199	Associate	★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	23610053		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	10983602, 11846196, 16423338, 21712624		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	16423338		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	26263539	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	37175429	Inhibit	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	10685360, 11669477, 14584862, 19053923, 22370044, 22795294, 26445016, 29023524, 31817464		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	Pubtator	22606001, 29023524	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periostitis	Periostitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30961664		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30961664		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	19010416		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	16595248, 19909950, 23375040, 28405733, 28678568		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	16595248		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	19909950, 23375040	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32785222	Stimulate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	10732829	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30271153		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23014359		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	12909295, 15201366, 31414991		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12169981		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	36167867	Associate	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	31270105		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	10898307		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16106254, 25374200		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16106254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16106254, 16284379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16106254, 23609451, 35821621	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	11851889, 19554025, 20631729, 22814393, 28645307, 30523673		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	19554025, 21792839, 22431714, 30968643, 34122426, 38115636	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	11851889, 22814393		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	15184943		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12952260, 18364273, 18579366, 22127713, 26722511	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34348529	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	18403674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22322675		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	12919285		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	19026124		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	12140751		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	11578018		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28915570		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	11182149		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	18838927, 23449693, 25089931, 30095747		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	18838927		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	11182149		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	27034593	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24490166	Stimulate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	34987646	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34544594	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	29312345		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16043936, 17607501, 19822442, 23168096		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	19822442, 34592495	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10366101, 11039782, 11477478, 11578018, 11838837, 11840694, 12028539, 12115161, 12407423, 12734885, 12932294, 1386092, 1395121, 14577650, 1458286, 14872281, 15931231, 15939878, 16200608, 16885604, 16886894, 17207379, 17223662, 17593860, 17867984, 18468936, 18500247, 19004046, 20141484, 20863445, 21059672, 21798287, 23006786, 24014495, 25726324, 26003199, 26521731, 26718437, 27105431, 28342152, 28606052, 29226727, 29553981, 29883212, 29998825, 30280295, 30859382, 31320744, 31376255, 31755595, 8003057, 8185691, 8507219, 9120311, 9646842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16200608, 16886894, 17593860		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274, 7706905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	11127488, 1531398	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	11790645, 9186988		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12804791, 14563376, 15318032, 16019233, 16905295, 20347268, 25284335, 28083609, 28815548, 29410009, 29898582, 30375100		★☆☆☆☆ Found in Text Mining only
Schnitzler Syndrome	Schnitzler Syndrome	CTD_human_DG	16096327		★☆☆☆☆ Found in Text Mining only
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	19608676, 31036740		★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Complex	Seizure	BEFREE	31709864		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	11514491, 19142372	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	20486195, 26813462	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	16436009	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35502507	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10446828, 20163933, 24428862, 25500257, 26184633, 28991823, 30099772, 31125901, 31567349, 31673705		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	28203105		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	14584862		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31086200	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	12407423		★☆☆☆☆ Found in Text Mining only
Snowflake vitreoretinal degeneration	Snowflake vitreoretinal degeneration	BEFREE	10027806, 12551827, 19142372		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	12847695, 33480001	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22796477, 25738940, 28242296, 8555013		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11705871		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19835631, 35634436, 38581865, 39310253	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	29395365		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	19010416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	27296494		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	19010416		★☆☆☆☆ Found in Text Mining only
Sterile multifocal osteomyelitis with periostitis and pustulosis	Sterile Multifocal Osteomyelitis With Periostitis And Pustulosis	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10463774, 11606496, 12530098, 12788304, 12854083, 12891537, 15233701, 15381184, 15540224, 15551344, 15688413, 15800325, 15851404, 15878285, 15927855, 16114018, 16284368, 16824064, 16985030, 17035400, 17096351, 17235630, 17295877, 17444864, 18047563, 18565646, 18628242, 18761558, 18779738, 18807132, 19607807, 19822419, 20222161, 20880168, 21243433, 22327782, 22714811, 24080970, 24557417, 24615437, 26632693, 27340011, 28110439, 29344744		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	26517486		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12133467, 15570075, 15927855, 16454826, 17035400, 17235630, 18565646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	15851404, 18628242, 19322919, 22714811, 23323013, 26632693, 27340011, 28058586, 30593746	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Associate	★☆☆☆☆ Found in Text Mining only
STRIATONIGRAL DEGENERATION, INFANTILE (disorder)	Striatonigral Degeneration	BEFREE	29510394		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	16980335, 17114844, 21607540, 24233813	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	17328808	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28298024		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	14585879		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	23584371		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	11561109, 12907945, 16934183		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	17963170, 21173013, 29609200, 30848528, 31599092		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16456536, 17444587		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	16456536		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	23472661		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	28612927		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	10690884, 19702713, 9112998, 9678537		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33238942	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33238942, 40304806	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	26097611	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	27530114		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	27530114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	10192196, 10321759, 10500062, 11173905, 11247888, 11606494, 11686217, 11740709, 14611908, 14735144, 16109659, 16804398, 18942754, 19643686, 20975573, 24776844, 25466956, 26316104, 29379540, 30417021, 7586694, 8119534, 8723412, 8899101, 8930557, 9014770, 9178675, 9203941, 9219791, 9414973, 9933456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	14611908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	30662368		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33267794	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	18186699, 23363559		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	24490166	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25925136	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17222831		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	21519029		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	18580969, 29944680		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24612355	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	BEFREE	10729297, 11094434, 12722027, 29513831, 31099056, 9186886		★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	12136897		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	22127713	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	31029578		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19129082, 29620037		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	29620037	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19129082, 29620037		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	32542038	Stimulate	★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	20682698		★☆☆☆☆ Found in Text Mining only