Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	353514
Gene name	Leukocyte immunoglobulin like receptor A5
Gene symbol	LILRA5
Synonyms (NCBI Gene)	CD85CD85FILT-11ILT11LILRB7LIR-9LIR9
Chromosome	19
Chromosome location	19q13.42
Summary	The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes

Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019221	hsa-miR-335-5p	Microarray	18185580
MIRT1109251	hsa-miR-1233	CLIP-seq
MIRT1109252	hsa-miR-2117	CLIP-seq
MIRT1109253	hsa-miR-3127-3p	CLIP-seq
MIRT1109254	hsa-miR-3667-3p	CLIP-seq
MIRT1109255	hsa-miR-4273	CLIP-seq
MIRT1109256	hsa-miR-4279	CLIP-seq
MIRT1109257	hsa-miR-4652-3p	CLIP-seq
MIRT2030347	hsa-miR-125a-3p	CLIP-seq
MIRT2030348	hsa-miR-3913-3p	CLIP-seq
MIRT2030349	hsa-miR-3934	CLIP-seq
MIRT2030350	hsa-miR-489	CLIP-seq
MIRT2030351	hsa-miR-640	CLIP-seq
MIRT2030352	hsa-miR-764	CLIP-seq
MIRT2561096	hsa-miR-217	CLIP-seq
MIRT2561097	hsa-miR-4252	CLIP-seq
MIRT2561098	hsa-miR-4299	CLIP-seq
MIRT2561099	hsa-miR-542-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IMP	12393390
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	19009525
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0032396	Function	Inhibitory MHC class I receptor activity	IBA
GO:0032695	Process	Negative regulation of interleukin-12 production	IDA	19009525
GO:0032696	Process	Negative regulation of interleukin-13 production	IDA	19009525
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	12393390, 19009525
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	19009525
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	12393390, 19009525
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12393390, 19009525
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	19009525
GO:0045087	Process	Innate immune response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12393390, 19009525
GO:0050867	Process	Positive regulation of cell activation	IDA	12393390
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	12393390
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IMP	19009525

MIM	HGNC	e!Ensembl
606047	16309	ENSG00000187116

A6NI73

Protein name

Leukocyte immunoglobulin-like receptor subfamily A member 5 (CD85 antigen-like family member F) (Immunoglobulin-like transcript 11) (ILT-11) (Leukocyte immunoglobulin-like receptor 9) (LIR-9) (CD antigen CD85f)

Protein function

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

PDB

2D3V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	46 → 135	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not

Sequence

MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRG
NSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYS
PAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHK
LSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAA
DNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR

Sequence length

299

Interactions

View interactions

	KEGG		Reactome
	Osteoclast differentiation B cell receptor signaling pathway		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19009525	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	39267096	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	39267096	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	39267096	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	39267096	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only

LILRA5 (leukocyte immunoglobulin like receptor A5)